Property Summary

NCBI Gene PubMed Count 137
PubMed Score 317.68
PubTator Score 907.80

Knowledge Summary

Patent

No data available

Gene RIF (139)

PMID Text
26667835 IL17F and IL17RA polymorphisms modulate susceptibility to cerebral malaria (CM) and provide evidence that IL-17F protects against CM.
26558270 A G/G genotype of rs766748 in IL-17F, and a C/C or C/A genotype of rs1883136 in TRAF3IP2.
26515887 The GGAGAA combined genotype and the GGA haplotype of IL-17A rs2275913, IL-17F rs763780 and rs2397084 can be considered risk factors for the development of systemic lupus erythematosus in Egyptian children.
26505366 No evidence of the association was observed between rs3748067, rs3819025, rs763780, rs9382084, and rs1266828 polymorphisms and the risk of cervical cancer.
26478573 higher expression level in chronic lymphocytic leukemia patients
26467330 Interleukin-17F gene polymorphism and its elevated serum levels are associated with recurrent pregnancy loss.
26464720 Genotyping of IL-17A rs2275913 and rs3748067 and IL-17F rs763780 genes was performed by multiplex PCR assays
26451724 data indicate that the genetic variants of rs2275913 in IL-17A, rs763780 in IL-17F, and rs4819554 in IL-17RA may not play a role in the pathogenesis of preeclampsia in Chinese Han women.
26447633 GA genotype of the rs11465553 IL17F gene polymorphism may be associated with a significantly higher risk of graft function loss and return to dialysis after kidney transplantation.
26445528 Review/Meta-analysis: The variant IL-17A-197A allele and IL-17F 7488CC genotype were associated with increased risk of cancer, especially for gastric cancer.
26436389 the IL-17A rs2275913 polymorphism may affect the development of coronary artery disease (CAD); however, no significant association was observed between the IL-17F rs763780 polymorphism and risk of CAD.
26415694 The results of the univariate analysis showed an association between rs10484879 and psoriasis, although this relationship disappeared after adjustment for HLA-C
26356122 expression of immunoreactivity for IL-17A, IL-17RA, IL-17E, and IL-17F was significantly elevated in prostatic tissue from benign prostatic hyperplasia and prostate cancer compared with that in controls
26345782 Genotyping analyses of IL-17A rs2275913 and rs3748067 and IL-17F rs763780 were analyzed
26339129 IL17F T7488C polymorphism was not associated with chronic periodontitis. In these patients from Southern Brazil
26337284 No associations were found between rs8193036, rs2275913 and rs3748067 in IL-17A and rs763780 in IL-17F SNPs and myasthenia gravis in Chinese patients
26300019 The polymorphism IL-17F rs1889570(C/T)may be a potential risk factor for asthma susceptibility.
26198032 In vitro, CSE stimulation significantly increased IL-17F and IL-17R in 16HBE (2.5%) and A549 (5%) while IL-17A and IL-17F in PBMC (10%). IL-17A and CSE stimulation, rather than CSE or rhIL-17A alone, increased proliferation in 16HBE and apoptosis in A549
26191290 IL-17F G single mutant and GG mutation homozygote were correlated with acute myeloid leukemia susceptibility
26164762 Results show that IL-17F (7488T/C) polymorphism may not associate with gastrointestinal diseases. However, AA genotype of IL-17A (-197G/A) may be an important predisposing factor in gastrointestinal diseases, especially in gastrointestinal cancer.
26154773 To investigate the impacts of these polymorphisms (IL-17A G197A, the IL-17F 7488A/G, and the IL-17F 7383A/G) on the severity and susceptibility of RA in a Turkish population.
26125910 The IL-17A rs2275913G>A and IL-17F rs763780T>C polymorphisms are risk factors for gastric cancer development. (Meta-analysis)
26119194 The effect of IL-17 cytokine in pre-eclampsia is not due to the studied cytokine polymorphisms but local production of IL-17 might have an effect on the predisposition to the disease.
26108303 Correlation analysis of SNPs to different clinical variables showed a significant correlation between IL-17F rs1889570 SNP and the number of allergens sensitized
26083022 IL17F may serve as an independent prognostic factor for overall survival in patients with colorectal cancer.
26079624 Increased expression of TLR2 contributes to immune reactivity and promotes IL-17A and IL-17F expression through histone modifications in systemic lupus erythematosus.
26045845 suggest that IL-17F rs763780 play a critical role in the etiology of pulmonary tuberculosis
25857634 single nucleotide polymorphisms in the proinflammatory IL17A and IL17F genes (rs2275913 and rs763780, respectively), were not significantly associated with tuberculosis in the Croatian population.
25680555 the T allele of IL-17F T7488C polymorphism may be involved in reduced risk of colorectal cancer
25613064 the serum level of IL-17F and the ratio of IL-17F/VEGF were positively associated with the numbers of CD3(+) CD4(+) T cells, which indicated that serum IL-17F could originate from PBMCs during the development of oral squamous cell carcinoma
25596084 But we did not observe a significant association between polymorphisms in rs3748067, rs3819025, rs763780, rs9382084, and rs1266828 polymorphisms ( IL-17A and IL-17F )and risk of cervical cancer.
25579009 IL-17A and IL-17F polymorphisms can interact with smoking and drinking to enhance the risk of OSCC developing
25525302 IL-23 has a role in regulating IL-17A and/or IL-17F positive Th17 cells in chronic periodontitis
25500254 IL-17A rs2275913 A/G polymorphism and IL-17F rs763780 C/T polymorphism might be associated with increased gastric cancer risk in Asians.
25439430 High gene copy numbers of IL17F and IL23A were associated with Behcet's disease and Vogt-Koyanagi-Harada syndrome.
25427574 Expression of both IL-17A and IL-17 F is increased by the cigarette smoke exposure in explants from both non-COPD and COPD subjects, supporting that local lung cells contribute IL-17 production.
25394579 nasal IL-17F inflammation might be informative of bronchial IL-17 inflammatory pattern associated with bronchial neutrophilia in SA prone to asthma exacerbations.
25384562 This study indicates that IL-17F may be involved in pathogenesis of periodontitis like IL-17A.
25374205 IL-17F 7488A/G is associated with susceptibility to silicosis.
25338988 IL-17A rs763780T>C gene polymorphism is involved in risk of gastric cancer.
25240765 IL-17F plasma levels were increased in rheumatoid arthritis patients and responsive to anti-rheumatic agents.
25227691 Polymorphisms in the IL17F gene are associated with recurrent pregnancy loss in Iranian women.
25030504 IL-17A/F is highly expressed by innate immune cells such as neutrophils and mast cells in both acute generalized exanthematous pustulosis and generalized pustular psoriasis.
24965422 IL-17F T7488C polymorphism did not increase or decrease cancer risk under all genetic models
24935327 results suggest that patients carrying a combination of SNPs for TNF-alpha, VEGF-A, and IL-17F of ACGTCT haplotype may have an increased risk of corneal allograft rejection compared with patients carrying other haplotypes
24933943 The contribution of the studied IL-17 F T7488C, TNF-alpha G-308A gene polymorphisms is highly related to the disease phenotype manifestations and peculiar issues associated with therapy volume.
24913709 Studies suggest that interleukin-17F (IL-17F) polymorphism may modify the risk of cancer, particularly gastric cancer.
24857622 A significantly increased frequency of rs763780 genotype and T allele in IL-17f was detected in Multiple Sclerosis patients compared with controls.
24793548 The rs763780 IL-17F polymorphism appeared to be associated with susceptibility to the disease.
24690400 IL17F rs763780 polymorphism is inversely associated with development of subacute sclerosing panencephalitis.
24621498 IL-15 and IL-17F are differentially regulated and expressed in MF. We propose that IL-15 and IL-17F are markers for different inflammatory environments and play distinct roles in the development and progression of MF.
24548421 The association of three single-nucleotide polymorphisms (SNPs: -152 G/A, 7488 A/G and 7383 A/G) in the IL-17A and IL-17F genes with lung cancer risk, was investigated.
24507036 IL-17F gene SNP 7489A/G is associated with renal graft failure
24440568 genetic polymorphism is associated with clinical features of colorectal cancer in Tunisia
24423465 contributes to colon cancer development
24393079 IL-17F gene variants associated with childhood asthma susceptibility in Tunisia.
24363402 Recombinant IL-17A and IL-17F significantly inhibit Fas-induced cell death in Fas-sensitive T cells from healthy donors.
24185279 IL-17F was discriminatively regulated by testosterone and 17beta-estradiol in resident periodontal cells.
24164796 The IL-17F (7488T>C) single-nucleotide polymorphism is associated with susceptibility to leprosy.
24120361 Human IL-17A and IL-17F depend on ACT1 to mediate protective mucocutaneous immunity.
24096234 employed a PCR-SSCP assay to identify the genotypes IL-17A G-197A and IL-17F T7488C. For IL-17A G-197A, there were significant differences in frequencies of genotype and allele of IL-17A G-197A between OA patients and controls
23876429 There is no association between the IL17A and IL17F gene polymorphisms and tuberculosis in north Indians.
23801634 interleukin-17F may have a role in cutaneous T-cell lymphoma
23800789 the IL17A and IL17F loci have divergent epigenetic architectures in unstimulated HuT-102 and primary Th17 cells.
23661335 IL-17A, IL-17B, IL-17F and IL-23 in systemic lupus erythematosus patients were examined and the correlation between levels of the investigated cytokines and VEGF, PIGF, as well as number of endothelial cells, was investigated.
23652560 IL17F rs763780 polymorphisms may influence the susceptibility to Crohn's Disease in the Chinese Han population.
23519962 These findings suggested that the IL-17F 7488C allele could be significantly associated with protection against encephalitis in Chinese patients with Enterovirus 71-related hand, foot, and mouth disease.
23490420 These experiments were designed to investigate the effects of IL-17 upon the phenotype and function of human Natural Killer (NK) cells.
23400328 cooperative interactions between fibrocytes and Th17 cells play an important role via CD40- and IL-17A/F-mediated signaling for collagen and proangiogenic factor production, which may lead to extracellular matrix deposition and neovascularization
23376081 Results indicate that SNP rs763780 of IL-17F was associated with male dilated cardiomyopathy (DCM) patients in a dominant genetic model.
23238559 A large burden of neutrophils, neutrophil extracellular traps and IL17A and -F are important constituents of fresh and lytic thrombus after acute myocardial infarction.
23219503 The tuberculosis patients who had the CT/TT genotype of the rs763780 SNP in the IL17F gene were more susceptible to tuberculosis, compared to the CC genotype.
23137879 No association was found considering the IL17F and IL23R polymorphisms. Our data suggest that IL17A and the presence of IL17A (rs2275913) A allele are associated with the absence of periodontal disease.
23111159 polymorphisms in the IL-17F gene increase the risk of Graves' Disease and that IL-17F is therefore a good candidate gene for Graves' Disease prediction in the Han Chinese population.
22847545 Increased serum circulatory levels of interleukin 17F in type 1 reactions of leprosy correlate with the greater protective immunity.
22812194 polymorphism is associated with asthma in male Chinese population
22748467 results suggest that in chronic hepatitis C infection, IL-17F and IL-8 could be associated with the control of liver injury and infection, respectively.
22629719 Dynamics of serum IL-17A, IL-17F and IL-23 in patients with inflammatory bowel disease
22579472 IL17F gene polymorphism 7488T>C influences bone mineral density.
22540331 data suggest that the IL-33/IL-17F axis is involved in allergic airway inflammation
22507625 IL17A and IL17F SNPs, and some intergenic variants have the potential association with allergic rhinitis and comorbid asthma in Chinese population.
22461912 Results suggested that single-nucleotide polymorphisms (SNPs) in IL-17A but not IL-17F were associated with the risk of breast cancer.
22312940 Of all the SNPs analyzed of IL17A and IL17F, only rs17880588 showed a significant association with asthma in the Saudi population.
22219048 results provide evidence that Th17 cytokines IL-17A and IL-17F have a distinct regulatory role in CXCL1, CXCL5, and CXCL8 expression in lung microvascular endothelial cells stimulated either with IL-1beta or with TNF-alpha
22184122 cAMP-responsive element modulator alpha (CREMalpha) suppresses IL-17F protein expression in T lymphocytes from patients with systemic lupus erythematosus (SLE).
22142827 The angiogenetic potential of pancreatic cancers in patients with variant IL-17F is higher than that of tumors in patients with wild-type IL-17F, conferring worse prognosis.
22123224 These novel findings provide evidence that cytokine-stimulated B lymphocytes could be a significant source of IL-17A and IL-17F and support the notion that these cells actively participate in immune responses via alternative mechanisms in addition to the classic release of antibodies.
22118860 Significantly higher frequencies of the rs763780 T allele and TT genotype of IL17F were observed in neuromyelitis optica patients versus controls
22038405 DNA copy number variations of IL-17F, IL-21, and IL-22 are associated with the risk of systemic lupus erythematosus.
21615796 IL-17F 7488 T allele is significantly associated with the development of chronic ITP, suggesting a role for IL-17F in the pathogenesis of chronic immune thrombocytopenia.
21601196 These findings suggest that IL-17F may stimulate the development of endometriosis by up-regulation of IL-8 and COX2.
21477350 CD8-positive T-cells express IL-17F which may be involved in the pathogenesis of chronic obstructive pulmonary disease.
21419044 After renaturation and purification of IL-17F, the recombinant protein can up-regulate macrophages to secret TNF-alpha, IL-6 and other relative cytokines. It also promoted proliferation of HeLa cells in vitro.
21196754 gene polymorphism is associated with susceptibility to asthma in a Korean population
21189442 a twenty-fold increase in the expression of IL-17A mRNA and thirty three-times greater expression of IL-17F in Multiple sclerosis patients compared to the control group
21044126 H. pylori infection leads to a strong upregulation of both IL-17A and IL-17F in the gastric mucosa suggesting a regulatory link between both genes.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20620187 genetic polymorphism is associated with Vogt-Koyanagi-Harada syndrome but not with Behcet's disease in a Chinese Han population
20620187 Observational study of gene-disease association. (HuGE Navigator)
20618772 investigated the association between rheumatoid arthritis (RA) and His161Arg (7488A/G; rs763780) and Glu126Gly (7383A/G; rs2397084) polymorphism of IL-17F gene; results showed the relationship between IL-17F gene polymorphisms and severity of RA
20618772 Observational study of gene-disease association. (HuGE Navigator)
20493423 IL-17 isoforms (IL-17A and IL-17F) are implicated in systemic lupus erythematosus but also in discoid and subacute lupus erythrmatosis immunopathogenesis
20237496 Observational study of gene-disease association. (HuGE Navigator)
20210523 IL-17F, a novel antiangiogenic factor, directly inhibited ECV304 vascular endothelial cell growth and downregulated the expression of proangiogenic factors IL-6, IL-8, and VEGF in hepatocarcinoma cells.
20173782 Observational study of gene-disease association. (HuGE Navigator)
20148256 produced by CD4+ T cells in psoriatic skin lesions
20127054 Results suggest that genetic polymorphisms of IL-17A and MIF, but not IL-17F, are associated with CpG island hyper-methylation status in gastric cancer.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19904747 Observational study of gene-disease association. (HuGE Navigator)
19838198 present the crystal structure of a complex of IL-17 receptor A (IL-17RA) bound to IL-17F in a 1:2 stoichiometry.
19838108 The IL-17F His161Arg polymorphism is unlikely to be a major contributor to the pathogenesis of myocardial infarction.
19838108 Observational study of gene-disease association. (HuGE Navigator)
19724898 No association were found between CpG island hyper-methylati status and L-17A (-197G>A), IL-17F (7488T>C) and MIF (-173G>C) polymorphism.
19724898 Observational study of gene-disease association. (HuGE Navigator)
19414056 Results show that G-197A polymorphism of IL-17A gene was significantly associated with the development of gastric cancer, especially intestinal-type cancer.
19414056 Observational study of gene-disease association. (HuGE Navigator)
19263269 This study shows that IL-17F 7488 A > G polymorphism is associated with weak UC protection in the Chinese population.
19263269 Observational study of gene-disease association. (HuGE Navigator)
19155467 Although transgenic strain IL-17F expression is restricted to CD4-positive T cells during murine experimental autoimmune encephalomyelitis, CD8 T cells robustly express IL-17F.
19019635 IL-17F single nucleotide polymorphism is not associated with psoriasis vulgaris or atopic dermatitis in the Japanese population.
18830271 IL-17F may be involved in psoriasis via, in part, the activation of ERK1/2 and the induction of IL-8 in keratinocytes
18774769 The association between chronic fatigue syndrome and the frequency of rs763780, a C/T genetic polymorphism leading to His161Arg substitution in the IL-17F protein was studied.
18774769 Observational study of gene-disease association. (HuGE Navigator)
18769923 Observational study of gene-disease association. (HuGE Navigator)
18684971 Human IL-17F/IL-17A heterodimer can bind and signal through the same receptor complex as human homodimeric cytokines IL-17F and IL-17A.
18088064 Intestinal IL17F gene expression is increased in active CD
18088064 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17912466 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17912466 These results provide the first evidence that the IL-17F and MIF gene polymorphisms are significantly associated with the development of functional dyspepsia.
17828618 Our results provided the first evidence that -197A (IL-17A) and 7488T (IL-17F) alleles may influence the susceptibility to and pathophysiological features of ulcerative colitis independently.
17828618 Observational study of gene-disease association. (HuGE Navigator)
17418381 IL-17F induces expression of IFN-gamma-inducible protein 10 (IP-10) by activating Raf1-mitogen-activated protein kinase 1/2-extracellular-regulated kinase 1/2-p90 ribosomal S6 kinase-cyclic AMP response element-binding protein signaling pathway.
17346928 This study, for the first time, reveals a possible molecular mechanism that the initiation of the IL-17F/IL-17R signaling pathway requires the receptor ubiquitination by TRAF6.
16961709 Observational study of gene-disease association. (HuGE Navigator)
16630936 Observational study of gene-disease association. (HuGE Navigator)
15972674 cell membrane IL-17R is required for signaling by both IL-17A and IL-17F
15703761 Observational study of gene-disease association. (HuGE Navigator)
11891214 a cytokine involved in the activaion of MAP kinases

AA Sequence

MTVKTLHGPAMVKYLLLSILGLAFLSEAAARKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSM      1 - 70
SRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVS     71 - 140
FQLEKVLVTVGCTCVTPVIHHVQ                                                   141 - 163
//

Text Mined References (140)

PMID Year Title
26667835 2015 The IL17F and IL17RA Genetic Variants Increase Risk of Cerebral Malaria in Two African Populations.
26558270 2015 Genetic Polymorphisms of IL-17F and TRAF3IP2 Could Be Predictive Factors of the Long-Term Effect of Infliximab against Crohn's Disease.
26515887 2016 Interleukin-17A rs2275913, Interleukin-17F rs763780 and rs2397084 gene polymorphisms as possible risk factors in Juvenile lupus and lupus related nephritis.
26505366 2015 Association analysis of IL-17A and IL-17F polymorphisms in Chinese women with cervical cancer.
26478573 2015 Identification and characterization of distinct IL-17F expression patterns and signaling pathways in chronic lymphocytic leukemia and normal B lymphocytes.
26467330 2015 Interleukin-17 and leptin genes polymorphisms and their levels in relation to recurrent pregnancy loss in Egyptian females.
26464720 2015 Association between interluekin-17 gene polymorphisms and the risk of cervical cancer in a Chinese population.
26451724 2015 Role of IL-17 Variants in Preeclampsia in Chinese Han Women.
26447633 2015 Influence of the IL17A and IL17F gene polymorphisms on the long-term kidney allograft function and return to dialysis after kidney transplantation.
26445528 2015 The IL-17A G-197A and IL-17F 7488T/C polymorphisms are associated with increased risk of cancer in Asians: a meta-analysis.
26436389 2015 Correlation between polymorphisms in the IL-17A and IL-17F genes and development of coronary artery disease.
26415694 2015 The polymorphism rs763780 in the IL-17F gene is associated with response to biological drugs in patients with psoriasis.
26356122 2015 Expression of IL-17A, E, and F and their receptors in human prostatic cancer: Comparison with benign prostatic hyperplasia.
26345782 2015 Influence of interleukin-17 gene polymorphisms on the development of pulmonary tuberculosis.
26339129 2015 The Influence of Interleukin 17A and IL17F Polymorphisms on Chronic Periodontitis Disease in Brazilian Patients.
26337284 2016 Association study between IL-17A and IL-17F gene polymorphism and myasthenia gravis in Chinese patients.
26300019 2015 IL-17 polymorphisms and asthma risk: a meta-analysis of 11 single nucleotide polymorphisms.
26198032 2015 Cigarette smoke affects IL-17A, IL-17F and IL-17 receptor expression in the lung tissue: Ex vivo and in vitro studies.
26191290 2015 Correlation between acute myeloid leukemia and IL-17A, IL-17F, and IL-23R gene polymorphism.
26164762 2015 A meta-analysis: The association between interleukin-17 pathway gene polymorphism and gastrointestinal diseases.
26154773 2015 The Influence of Polymorphisms of Interleukin-17A and -17F Genes on Susceptibility and Activity of Rheumatoid Arthritis.
26125910 2015 IL-17A and IL-17F polymorphisms and gastric cancer risk: a meta-analysis.
26119194 2015 Investigating the Association of IL-17A and IL-17F with Susceptibility to Pre-eclampsia in Iranian Women.
26108303 2015 IL-10 and IL-17F Promoter Single Nucleotide Polymorphism and Asthma: A Case-Control Study in South India.
26083022 2015 Involvement of IL17A, IL17F and IL23R Polymorphisms in Colorectal Cancer Therapy.
26079624 2015 Increased expression of TLR2 in CD4(+) T cells from SLE patients enhances immune reactivity and promotes IL-17 expression through histone modifications.
26045845 2015 StIL-17 gene polymorphisms in the development of pulmonary tuberculosis.
25857634 2015 Genetic Polymorphisms in the Toll-like Receptor 10, Interleukin (IL)17A and IL17F Genes Differently Affect the Risk for Tuberculosis in Croatian Population.
25680555 2015 Interleukin-17FT7488 allele is associated with a decreased risk of colorectal cancer and tumor progression.
25613064 2015 Serum IL-17F combined with VEGF as potential diagnostic biomarkers for oral squamous cell carcinoma.
25596084 2015 Association between six genetic variants of IL-17A and IL-17F and cervical cancer risk: a case-control study.
25579009 2015 Interleukin 17A and interleukin 17F polymorphisms are associated with oral squamous cell carcinoma susceptibility in a Chinese population.
25525302 2014 Clinical significance of IL-23 regulating IL-17A and/or IL-17F positive Th17 cells in chronic periodontitis.
25500254 2015 Association of IL-17A and IL-17F polymorphisms with gastric cancer risk in Asians: a meta-analysis.
25439430 2015 Genetic variations of IL17F and IL23A show associations with Behçet's disease and Vogt-Koyanagi-Harada syndrome.
25427574 2014 Upregulation of IL-17A/F from human lung tissue explants with cigarette smoke exposure: implications for COPD.
25416956 2014 A proteome-scale map of the human interactome network.
25394579 2015 Nasal IL-17F is related to bronchial IL-17F/neutrophilia and exacerbations in stable atopic severe asthma.
25384562 2015 Overexpression and Potential Regulatory Role of IL-17F in Pathogenesis of Chronic Periodontitis.
25374205 2014 Association between polymorphisms of interleukin-17A and interleukin-17F genes and silicosis susceptibility in Chinese Han people.
25338988 2014 Meta analysis of association of the IL-17F rs763780T>C gene polymorphism with cancer risk.
25240765 2015 Increased plasma IL-17F levels in rheumatoid arthritis patients are responsive to methotrexate, anti-TNF, and T cell costimulatory modulation.
25227691 2014 Association of IL-17A and IL-17 F gene polymorphisms with recurrent pregnancy loss in Iranian women.
25030504 2014 Innate immune cells express IL-17A/F in acute generalized exanthematous pustulosis and generalized pustular psoriasis.
24965422 IL-17A G197A and IL-17F T7488C polymorphisms and cancer risk in Asian populations: a meta-analysis.
24935327 2014 Haplotype analysis on chromosome 6p of tumor necrosis factor alpha, vascular endothelial growth factor A, and interleukin-17F alleles associated with corneal transplant rejection.
24933943 2013 [Prognostic factors of ulcer colitis flow].
24913709 2014 Role of IL-17F T7488C polymorphism in carcinogenesis: a meta-analysis.
24857622 2014 IL-17F but not IL-17A gene polymorphism confers risk to multiple sclerosis in a Chinese Han population.
24793548 2014 IL-17F gene polymorphism is associated with susceptibility to acute myeloid leukemia.
24690400 2014 May TLR4 Asp299Gly and IL17 His161Arg polymorphism be associated with progression of primary measles infection to subacute sclerosing panencephalitis?
24621498 2014 IL-15 and IL-17F are differentially regulated and expressed in mycosis fungoides (MF).
24548421 2014 Interleukin-17A and -17F genes polymorphisms in lung cancer.
24507036 Association of IL-17F gene polymorphisms with renal transplantation outcome.
24440568 Significant association between IL23R and IL17F polymorphisms and clinical features of colorectal cancer.
24423465 2014 Interleukin-17F attenuates H2O2-induced cell cycle arrest.
24393079 2014 IL-17A and IL-17F genes variants and susceptibility to childhood asthma in Tunisia.
24363402 2014 IL-17 protects T cells from apoptosis and contributes to development of ALPS-like phenotypes.
24185279 Verification of IL-17A and IL-17F in oral tissues and modulation of their expression pattern by steroid hormones.
24164796 2014 Interleukin-17F single-nucleotide polymorphism (7488T>C) and its association with susceptibility to leprosy.
24120361 2013 An ACT1 mutation selectively abolishes interleukin-17 responses in humans with chronic mucocutaneous candidiasis.
24096234 2014 Association of IL-17A and IL-17F single nucleotide polymorphisms with susceptibility to osteoarthritis in a Korean population.
23876429 2013 Lack of association between IL17A and IL17F polymorphisms and related serum levels in north Indians with tuberculosis.
23801634 2013 Elucidating the role of interleukin-17F in cutaneous T-cell lymphoma.
23800789 2013 The IL17A and IL17F loci have divergent histone modifications and are differentially regulated by prostaglandin E2 in Th17 cells.
23661335 2013 Correlations between concentrations of interleukin (IL)-17A, IL-17B and IL-17F, and endothelial cells and proangiogenic cytokines in systemic lupus erythematosus patients.
23652560 2013 Genetic polymorphisms of interleukin 17A and interleukin 17F and their association with inflammatory bowel disease in a Chinese Han population.
23519962 2013 Association of interleukin-17F gene polymorphism with enterovirus 71 encephalitis in patients with hand, foot, and mouth disease.
23490420 2013 The effects of IL-17 upon human natural killer cells.
23400328 2013 IL-17A/F modulates fibrocyte functions in cooperation with CD40-mediated signaling.
23376081 2013 Analysis of IL-17 gene polymorphisms in Chinese patients with dilated cardiomyopathy.
23238559 2013 Neutrophils, neutrophil extracellular traps and interleukin-17 associate with the organisation of thrombi in acute myocardial infarction.
23219503 2013 The IL-17F sequence variant is associated with susceptibility to tuberculosis.
23137879 2013 Evaluation of IL17A expression and of IL17A, IL17F and IL23R gene polymorphisms in Brazilian individuals with periodontitis.
23111159 2013 Genetic association between IL-17F gene polymorphisms and the pathogenesis of Graves' Disease in the Han Chinese population.
22847545 2012 Increased serum circulatory levels of interleukin 17F in type 1 reactions of leprosy.
22812194 2012 Association between polymorphisms in IL17F and male asthma in a Chinese population.
22748467 2012 Serum levels of Th17 associated cytokines in chronic hepatitis C virus infection.
22629719 2011 [Dynamics of serum IL-17A, IL-17F and IL-23 in patients with inflammatory bowel disease].
22579472 2012 The IL6 gene polymorphism -634C>G and IL17F gene polymorphism 7488T>C influence bone mineral density in young and elderly Japanese women.
22540331 2012 Interleukin-33 induces interleukin-17F in bronchial epithelial cells.
22507625 2012 Association between polymorphisms in cytokine genes IL-17A and IL-17F and development of allergic rhinitis and comorbid asthma in Chinese subjects.
22461912 2012 Association analysis of IL-17A and IL-17F polymorphisms in Chinese Han women with breast cancer.
22312940 2011 Interleukin 17A and F and asthma in Saudi Arabia: gene polymorphisms and protein levels.
22219048 2012 A distinct regulatory role of Th17 cytokines IL-17A and IL-17F in chemokine secretion from lung microvascular endothelial cells.
22184122 2012 cAMP-responsive element modulator ? (CREM?) suppresses IL-17F protein expression in T lymphocytes from patients with systemic lupus erythematosus (SLE).
22142827 2012 A genome-wide association study of overall survival in pancreatic cancer patients treated with gemcitabine in CALGB 80303.
22123224 2012 IL-17A and IL-17F expression in B lymphocytes.
22118860 2012 Interleukin 17 gene polymorphism is associated with anti-aquaporin 4 antibody-positive neuromyelitis optica in the Southern Han Chinese--a case control study.
22038405 2011 Copy number variations of interleukin-17F, interleukin-21, and interleukin-22 are associated with systemic lupus erythematosus.
21615796 2011 Interleukin-17F gene polymorphism in patients with chronic immune thrombocytopenia.
21601196 2011 Interleukin-17F increases the secretion of interleukin-8 and the expression of cyclooxygenase 2 in endometriosis.
21477350 2011 CD8 positive T cells express IL-17 in patients with chronic obstructive pulmonary disease.
21419044 2011 [Prokaryotic expression and biological activity of recombinant human IL-17F/His protein].
21350122 2011 Chronic mucocutaneous candidiasis in humans with inborn errors of interleukin-17 immunity.
21196754 2011 Significant association between IL-17F promoter region polymorphism and susceptibility to asthma in a Korean population.
21189442 2010 Interleukin-17A and interleukin-17F mRNA expression in peripheral blood mononuclear cells of patients with multiple sclerosis.
21044126 2010 IL-17A and IL-17F gene expression is strongly induced in the mucosa of H. pylori-infected subjects from Kenya and Germany.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20620187 2010 Interleukin-17 gene polymorphism is associated with Vogt-Koyanagi-Harada syndrome but not with Behçet's disease in a Chinese Han population.
20618772 2010 Association between IL-17F gene polymorphisms and susceptibility to and severity of rheumatoid arthritis (RA).
20493423 2010 IL-17 in cutaneous lupus erythematosus.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20210523 2010 Interleukin-17F suppresses hepatocarcinoma cell growth via inhibition of tumor angiogenesis.
20173782 2010 Prognostic significance of genetic variants in the IL-23/Th17 pathway for the outcome of T cell-depleted allogeneic stem cell transplantation.
20148256 2010 Involvement of IL-17F via the induction of IL-6 in psoriasis.
20127054 2010 Association between IL-17A, -17F and MIF polymorphisms predispose to CpG island hyper-methylation in gastric cancer.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19904747 2010 Association between polymorphisms in interleukin-17A and interleukin-17F genes and risks of gastric cancer.
19838198 2009 Structural basis of receptor sharing by interleukin 17 cytokines.
19838108 2009 Association analysis of the IL-17F His161Arg polymorphism in myocardial infarction.
19724898 2009 Effect of polymorphisms of IL-17A, -17F and MIF genes on CpG island hyper-methylation (CIHM) in the human gastric mucosa.
19414056 2009 Genetic polymorphism of interleukin-17A and -17F genes in gastric carcinogenesis.
19263269 2009 Association of interleukin-17F 7488 single nucleotide polymorphism and inflammatory bowel disease in the Chinese population.
19155467 2009 Cutting edge: an IL-17F-CreEYFP reporter mouse allows fate mapping of Th17 cells.
19019635 2009 IL-17F single nucleotide polymorphism is not associated with psoriasis vulgaris or atopic dermatitis in the Japanese population.
18830271 2009 Functional characterization of IL-17F as a selective neutrophil attractant in psoriasis.
18774769 2008 Lower frequency of IL-17F sequence variant (His161Arg) in chronic fatigue syndrome patients.
18769923 2008 Interleukin-17F gene polymorphisms in Korean patients with Behçet's disease.
18684971 2008 The human IL-17F/IL-17A heterodimeric cytokine signals through the IL-17RA/IL-17RC receptor complex.
18088064 2008 Role of the novel Th17 cytokine IL-17F in inflammatory bowel disease (IBD): upregulated colonic IL-17F expression in active Crohn's disease and analysis of the IL17F p.His161Arg polymorphism in IBD.
17912466 2007 Genetic polymorphisms of molecules associated with inflammation and immune response in Japanese subjects with functional dyspepsia.
17911633 2007 Identification of the IL-17 receptor related molecule IL-17RC as the receptor for IL-17F.
17828618 2008 The influence of polymorphisms of interleukin-17A and interleukin-17F genes on the susceptibility to ulcerative colitis.
17418381 2007 The IL-17F signaling pathway is involved in the induction of IFN-gamma-inducible protein 10 in bronchial epithelial cells.
17355969 2007 Identification of an interleukin 17F/17A heterodimer in activated human CD4+ T cells.
17346928 2007 Interleukin-17F signaling requires ubiquitination of interleukin-17 receptor via TRAF6.
16961709 2006 Role of interleukin-17F in chronic inflammatory and allergic lung disease.
16630936 2006 IL-17F sequence variant (His161Arg) is associated with protection against asthma and antagonizes wild-type IL-17F activity.
15972674 2005 Role of IL-17A, IL-17F, and the IL-17 receptor in regulating growth-related oncogene-alpha and granulocyte colony-stimulating factor in bronchial epithelium: implications for airway inflammation in cystic fibrosis.
15703761 2005 Polymorphisms in the interleukin 17F gene (IL17F) and asthma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11891214 2002 Activation of extracellular signal-regulated kinase (ERK)1/2, but not p38 and c-Jun N-terminal kinase, is involved in signaling of a novel cytokine, ML-1.
11591768 2001 Identification of a novel cytokine, ML-1, and its expression in subjects with asthma.
11591732 2001 Cutting edge: IL-17F, a novel cytokine selectively expressed in activated T cells and monocytes, regulates angiogenesis and endothelial cell cytokine production.
11574464 2001 IL-17s adopt a cystine knot fold: structure and activity of a novel cytokine, IL-17F, and implications for receptor binding.