Property Summary

NCBI Gene PubMed Count 12
PubMed Score 17.37
PubTator Score 8.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Gene RIF (7)

AA Sequence

MLVAGFLLALPPSWAAGAPRAGRRPARPRGCADRPEELLEQLYGRLAAGVLSAFHHTLQLGPREQARNAS      1 - 70
CPAGGRPADRRFRPPTNLRSVSPWAYRISYDPARYPRYLPEAYCLCRGCLTGLFGEEDVRFRSAPVYMPT     71 - 140
VVLRRTPACAGGRSVYTEAYVTIPVGCTCVPEPEKDADSINSSIDKQGAKLLLGPNDAPAGP            141 - 202
//

Text Mined References (14)

PMID Year Title