Property Summary

NCBI Gene PubMed Count 888
PubMed Score 4274.15
PubTator Score 2471.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Plaque psoriasis 14
Disease Target Count P-value
ulcerative colitis 2087 2.5e-03

Synonym

Accession Q16552 Q5T2P0 IL-17
Symbols IL17
CTLA8
IL-17
CTLA-8
IL-17A

Gene

PDB

4HSA   2VXS   4HR9   4QHU   5HHV   5HHX   5HI3   5HI4   5HI5  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (6)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
624278 other 1 / 0 / 0 Late stage assay provider counterscreen from the probe development effort to identify selective inverse agonists of the Retinoic acid receptor-related Orphan Receptor Gamma (RORC): Fluorescence-based cell-based QPCR assays to determine endogenous expression of ROR gamma target genes, proinflammatory IL-17 and IL-23R

Gene RIF (872)

PMID Text
27049090 IL-17A content of the ulcerative colitis group and Crohns disease group was significantly higher than that of the normal control group
26910014 The presence of allele A in the IL-17 gene polymorphism (-197A/G) can be considered a risk factor for the development of chronic periodontitis and localized aggressive periodontitis.
26890073 no difference was observed in acute gout patients between different genotypic carriers of rs2275913 and rs763780 regarding serum IL-17A and IL-17F levels (p>0.05).
26875893 IL-17A promotes migration of hepatocellular carcinoma cells and prevents autophagic cell death from starvation by activating TAB2/p38 MAPK and TAB3/p38 MAPK.
26867135 IL-17A and IL-22 work synergistically to induce antimicrobials and chemokines such as IL-8, components of calprotectin (CP), lipocalin (LCN) and some beta-defensins in both human and primary mouse gastric epithelial cells (GEC) and gastroids
26850593 These results indicate an essential role for MAPKs in the induction of MMP-3 in synovial sarcoma cells, through AP-1 activation.
26840977 The results show a protective effect of IL17 and IL6 polymorphisms on Pulmonary Tuberculosis outcome in Southern Brazilian population.
26805737 IL-17 plays a role in lung cancer progression via different mechanisms. [review]
26783383 IL-17 might also be a culprit in bone destruction caused by late stage bone metastasis[review]
26780388 IL-17A, and IL-17F, proinflammatory cytokines, similarly exhibited strong osteogenic effects when exposed directly to mesenchymal stem cells.
26771189 upregulated production of IL-17 may play an important role in regulating bone loss in osteoporotic postmenopausal women
26765636 rs7747909 in IL-17A may be associated with development of age-related macular degeneration and that this SNP can alter the ability of hsa-miR-4480 to bind and degrade IL-17A mRNA in vitro
26763436 Molecular phenotype of IL17A gene expression in psoriasis development is different in Asian and western population.
26744532 CD68(+)CD163(+) macrophages secreted cytokines, such as IL17A, that upregulated ERalpha expression.
26742440 IL-17 protein was higher in serum and mRNA was higher in disc tissue of patients with lumbar disc herniation compared to controls.
26742425 Taken together, our data show that enhanced expression of endothelial TF, which plays an important role in coagulopathy and splenic vein remodeling in liver cirrhosis, is induced by IL-17A in a ROS dependent manner.
26718973 IL-17 inhibited both the proliferation and migration of periodontal ligament stem cells
26709703 conditions allow IL-10 and IL-17 producing CD4 T cells to contribute to maintain tolerance to microbes locally, while retaining the ability to participate in protective immune responses at distant sites
26709006 elevated levels are associated with increased disease activity in patients with acute respiratory distress syndrome
26667768 CD45RO+ memory T-cells produce IL-17 in patients with atherosclerosis.
26656739 we showed that elevated IL-17/IL-23 serum concentrations helped to discriminate BP patients who later relapsed.
26642702 increased levels of NO and IL-17 may be related to dysregulated lymphocytes' immune response in children with influenza A viral pneumonia
26618234 study found elevations of plasma IL-17A prior to treatment in myasthenia gravis (MG) patients most likely to have thymic hyperplasia and with greater disease severity; also found patients with purely ocular MG more likely to develop generalized weakness with higher IL-17A levels; results further support the role of IL-17A in MG pathogenesis
26617905 suggest that individuals with the IL-17A AA genotype and the GA+AA genotype of rs2275913 are associated with an increased risk of coronary artery disease.
26616164 The present study showed that IL-17, in addition to stimulating an inflammatory response, negatively regulates the action of NGF and NGF R in the polar forms of the leprosy.
26602091 High amounts of IL-17, IP-10, and IL-10 were predictors of MOD; decreased IL-17 and MIP-1alpha separated CM-MOD from MOD; and increased IL-12p40 differentiated CM from CM-MOD
26583099 Th17 cells promote tumor growth by inducing angiogenesis (via IL-17) and by exerting themselves immunosuppressive functions
26558442 inhibits chondrogenesis in rheumatoid arthritis cartilage
26535675 rs2275913 polymorphism may play a role in the etiology of cervical cancer
26535650 our results suggest that the IL-17A rs3748067C>T and IL-17F rs763780 T>C polymorphisms play an important role in the risk of gastric cancer in a Chinese population.
26521730 inflammatory cytokines, including IL-17 and IL-22, are expressed at higher levels by inflamed OA synovium and suggest IL-22 involvement in OA pathophysiology.
26515887 The GGAGAA combined genotype and the GGA haplotype of IL-17A rs2275913, IL-17F rs763780 and rs2397084 can be considered risk factors for the development of systemic lupus erythematosus in Egyptian children.
26507122 results represent that human umbilical cord derived mesenchymal stem cells (hUC-MSCs) can promote the production of IL-17 from hPBMCs of systemic lupus erythematosus patients. Prostaglandin E2 is also critical for IL-17 production by hUC-MSCs
26505478 IL-17A appears to be involved in the pathogenesis of chronic inflammatory airway disease exacerbation, due to viral infection by promoting release of neutrophil chemoattractants from bronchial epithelial cells.
26505366 Analysis showed that the variant AA genotype of rs2275913 was associated with a significantly higher risk of cervical cancer than the wild-type GG genotype
26504859 This study demonstrates that Zn modulates IL-17 expression and provides a rationale for evaluating this compound as a supplementary agent in the treatment of chronic HCV.
26491867 Different monocyte subsets generate functional different osteoclasts which respond in distinct ways to IL17A.
26489621 IL-17 Induces MPTP opening through ERK2 and P53 signaling pathway in human platelets.
26481531 found significantly decreased gene expression in white cells and significantly decreased expression of IL-17A levels on CD4+ T-cells in Down Syndrome.
26468780 Results showed that SNP rs8193036, which is located upstream of the coding region of the IL17A gene, was slightly associated with protection against T. cruzi infection and associated with protection against the development of cardiomyopathy.
26467330 Interleukin-17A gene polymorphism and its elevated serum levels are associated with recurrent pregnancy loss.
26464720 our study suggests that IL-17A rs2275913 polymorphism may affect the development of cervical cancer
26461825 our study suggests the significant role of the cytokine IL-17A in the development of palmoplantar and pustular psoriasis
26456334 Neutralization of IL-17A and calcium channel blockers may thus represent novel therapeutic strategies for hyperparathyroidism.
26453305 TRAF5-mediated Lys-63-linked Polyubiquitination Plays an Essential Role in Positive Regulation of RORgammat in Promoting IL-17A Expression
26451724 The data indicate that the genetic variants of rs2275913 in IL-17A, rs763780 in IL-17F, and rs4819554 in IL-17RA may not play a role in the pathogenesis of preeclampsia in Chinese Han women.
26447633 GG genotype of the rs2275913 IL17A gene promoter polymorphism is associated with significantly impaired long-term kidney allograft function.
26445528 Review/Meta-analysis: The variant IL-17A-197A allele and IL-17F 7488CC genotype were associated with increased risk of cancer, especially for gastric cancer.
26440138 Studies indicate that Th17 cells-interleukin-17 (IL-17)-axis regulates inflammatory events in the nephritic kidney.
26436389 the IL-17A rs2275913 polymorphism may affect the development of coronary artery disease (CAD); however, no significant association was observed between the IL-17F rs763780 polymorphism and risk of CAD.
26400286 The study demonstrated the probable involvement of gamma delta T cells in the immune response of an organism via the secretion of IL-17 and IL-22.
26391982 HMGB1 and RAGE interaction may contribute to the inflammation of liver enhancing the expression of IL-17, which can be possibly restored through the decline of the HMGB1/RAGE axis in hepatitis B patients
26376306 These results indicate that IL-17 G-152A is associated with increased colonization rate of Streptococcus pneumoniae in young children, suggesting that IL-17A plays an important role in protection against pneumococcal colonization.
26374165 IL-17 downregulates Del1 expression through a GSK-3beta- and C/EBPbeta-dependent pathway.
26367076 Data show that the single nucleotide polymorphism of interleukin 17A (IL17A) gene is a risk factor for hepatocellular carcinoma (HCC) development may be through increased serum IL17 and IgE.
26356122 expression of immunoreactivity for IL-17A, IL-17RA, IL-17E, and IL-17F was significantly elevated in prostatic tissue from benign prostatic hyperplasia and prostate cancer compared with that in controls
26345782 Genotyping analyses of IL-17A rs2275913 and rs3748067 and IL-17F rs763780 were analyzed
26339129 In these patients from Southern Brazil, the IL17A rs2275913 polymorphisms, IL17A AA genotype, and the A allele were associated with a susceptibility to chronic periodontitis.
26337284 No associations were found between rs8193036, rs2275913 and rs3748067 in IL-17A and rs763780 in IL-17F SNPs and myasthenia gravis in Chinese patients
26302175 IL-17 may play a central role in the inflammatory cascade in the female genital tract, and may be induced in response to bacterial infections chlamydia and gonorrhoea.
26301881 Data show that serum interleukin 17 (IL-17) was elevated and the levels positively correlated with vascular endothelial growth factor (VEGF) concentration in non-small-cell lung cancer (NSCLC) patients.
26300019 The polymorphisms IL-17A rs4711998(A/G) and IL-17A rs3819024(A/G) may be potential risk factors for asthma susceptibility.
26296754 a significant positive correlation for ACE enzymatic activity and IL-17a levels was observed in SCZ (schizophrenia)patients.
26295034 Our data supports previous reports showing IL-17 and -23 upregulation in association with Multiple sclerosis and potentially identify a previously unknown involvement for CCL27.
26279438 IL-17 induced STAT3 activation as a necessary step in endothelial cell activation and neutrophil recruitment.
26263971 IL-17A expression in VAT is increased in morbidly obese women, which suggests a link between obesity and innate immunity in low-grade chronic inflammation in morbidly obese women.
26261639 we found that there was a significant association between L-17A rs2275913G>A polymorphism and increased gastric cancer risk, especially in H.pylori infection subjects.
26259585 endometriotic lesions produce IL-17A. removal of the lesion leads to reduction in systemic levels of IL-17A. data show an important role of IL-17A promoting angiogenesis and proinflammatory environment for establishment and maintenance of endometriosis.
26242299 Estrogen and progesterone decrease let-7f microRNA expression and increase IL-23/IL-23 receptor signaling and IL-17A production in patients with severe asthma.
26232149 elevated serum IL-17 level and sFlt-1/PlGF ratio had an additive (joint) effect on the risk of preeclampsia.
26223249 The rs3748067 G > A and rs8193036 C > T polymorphisms decrease CWP risk.
26208902 The presence of IL17A in tumor tissues isolated from invasive ductal breast carcinoma patients correlates with poor prognosis and a high expression of genes that promote the proliferation and survival of these tumors.
26205065 Serum levels of VEGF, IL-17, IL-10 and TNF-alpha were reduced in the pre-eclamptic pregnant women when compared with their normotensive peers.
26198928 Il-17 serum levels showed significant change in relapsing remitting multiple sclerosis patients after receiving high dose vitamin D3 for 12 weeks.
26198032 In vitro, CSE stimulation significantly increased IL-17F and IL-17R in 16HBE (2.5%) and A549 (5%) while IL-17A and IL-17F in PBMC (10%). IL-17A and CSE stimulation, rather than CSE or rhIL-17A alone, increased proliferation in 16HBE and apoptosis in A549
26191290 IL-17A and IL-23R gene polymorphism were not associated with acute myeloid leukemia susceptibility.
26191227 Plasma Il17 level was not altered in asthmatic children post Mycoplasma pneumonia infection.
26174551 A strong increase of Th17 cells producing immunosuppressive IL-10 was observed in acute myeloid leukemia patients compared with healthy donors.
26165685 IL-17 may play an important role in tumor dissemination in small cell lung cancer patients.
26164762 Results show that IL-17F (7488T/C) polymorphism may not associate with gastrointestinal diseases. However, AA genotype of IL-17A (-197G/A) may be an important predisposing factor in gastrointestinal diseases, especially in gastrointestinal cancer.
26154773 To investigate the impacts of these polymorphisms (IL-17A G197A, the IL-17F 7488A/G, and the IL-17F 7383A/G) on the severity and susceptibility of RA in a Turkish population.
26151690 Our results show that IL-17A, IL-17F and IL23R polymorphisms have no effect on expression of IL-6, IL-17, IL-21 and TGF-beta1 mRNAs expression in H. pylori-infected gastritis.
26125910 The IL-17A rs2275913G>A and IL-17F rs763780T>C polymorphisms are risk factors for gastric cancer development. (Meta-analysis)
26119194 The effect of IL-17 cytokine in pre-eclampsia is not due to the studied cytokine polymorphisms but local production of IL-17 might have an effect on the predisposition to the disease.
26115945 Genomic and proteomic studies are required to assess the possibility to use polymorphisms of IL17 gene as biomarkers of racial susceptibility to CVD in MS.
26083022 IL17A G197A SNP could be a risk factor for the inefficiency of chemotherapy and radiotherapy in colorectal cancer.
26079624 Increased expression of TLR2 contributes to immune reactivity and promotes IL-17A and IL-17F expression through histone modifications in systemic lupus erythematosus.
26077826 IL-17, a marker cytokine of Th17 cells, has been reported to be involved in the pathogenesis of rheumatoid arthritis, inflammatory bowel disease, and asthma.[review]
26073684 In conjunction with their major role in pathogenesis of SLE, baseline serum levels of IL-6 and IL-17 can be used as sensitive biomarkers for disease activity, as well as predictors of remission of lupus nephritis
26072972 The data indicate that TL1A may contribute to pathogenesis of inflammatory bowel diseases via local but not systemic induction of IL-17A but not IL-4, IL-13 or IFN-gamma.
26043025 Simvastatin reversed the IL-17A/IL-10 imbalance in the airways and reduced sputum macrophage but not neutrophil counts in patients with COPD.
26018190 Impaired M. tuberculosis Antigen-Specific IFN-gamma Response without IL-17 Enhancement in Patients with Severe Cavitary Pulmonary Tuberculosis
26017027 the distribution of interleukin (IL)-12 (IL12; 1188A/C), IL17 (A7488G) and IL-23 receptor (IL23R; +2199A/C) gene polymorphisms in patients with alopecia areata, was investigated.
26002979 The expansion of antigen-specific alpha-beta Th17 cells contributes to acute respiratory distress syndrome by local secretion of IL-17A, which in turn directly increases alveolar epithelial permeability.
25987798 IL-17 gene may be significantly correlated with gastric cancer risk in Asian populations, especially those carrying the rs2275913 G>A and rs763780 T>C polymorphisms[Meta-Analysis]
25975002 IL-17 has a direct effect on the decrease of Bcl-xl
25966103 Antiviral treatment of chronic hepatitis B virus patients with Baraclude alters serum migratory inhibitory factor, IL-17, and IL-10 levels.
25934649 sublingual immunotherapy for Japanese cedar pollinosis affects levels of IL-17A and complement components 3a and 5a
25933188 IL-7/IL-17 axis mediates chronic pelvic pain in experimental autoimmune prostatitis and in patients.
25922848 The data demonstrate that low baseline IL-17A levels are associated with better clinical response to TCZ treatment in RA patients.
25887118 potential biomarker for poor therapeutic response in lupus nephritis patients
25871515 Association between the IL17A rs2275913 G/A, rs3819024 A/G, rs3819025 G/A, rs4711998 A/G, rs8193036 C/T and rs8193037 G/A polymorphisms studied and the rheumatoid arthritis (RA) risk in a Chinese population; IL17A rs2275913 G/A and rs3819024 A/G alleles decrease the risk of RA, while IL17A rs3819025 G/A and rs8193036 C/T variant alleles increase the risk of RA.
25869448 It is an inflammatory cytokine produced by Tc17 cells and plays a role in progression of gastric cancer.
25857634 single nucleotide polymorphisms in the proinflammatory IL17A and IL17F genes (rs2275913 and rs763780, respectively), were not significantly associated with tuberculosis in the Croatian population.
25849622 Oncostatin M can regulate airway smooth muscle responses alone or in synergy with IL-17A.
25845273 serum levels elevated in intrahepatic cholestasis of pregnancy
25844618 IL-17A in the peripheral lung of patients with severe to very severe COPD may contribute to disease progression and development of lymphoid follicles via activation of CXCL12.
25842551 Serum IL-17 was inversely associated with diabetic retinopathy in type 2 diabetes patients.
25834404 findings suggest that IL-17 and its signaling pathways appear as promising new targets in the design and development of drugs for cancer prevention and treatment, particularly in colorectal cancer
25833686 we propose to call these IL-17A-dependent cells "foamy DCs" and discuss the possible existence of foamy DCs in atherosclerosis, a metabolic and inflammatory disorder involving IL-17A.
25794823 Summary utilises data from helminth infection models, to illustrate that IL-17 and neutrophils, typically associated with pro-inflammatory responses, are intimately linked with type 2 immunity. [Review]
25793426 Data suggest that up-regulation of IL17 (interleukin 17), IL23 (interleukin 23), and p73 (tumor protein p73) expression in cutaneous melanoma may be biomarker of melanoma invasiveness.
25776751 The role of IL-17 expression in valvular inflammation associated with streptococcus-induced endocarditis was studied.
25771887 serum levels markedly increased in Hashimoto thyroiditis patients
25740946 Demethylation of the RORC2 and IL17A in human CD4+ T lymphocytes defines Th17 origin of nonclassic Th1 cells.
25706309 revealed a tri-lateral relationship among HPV infection, Stat3 activity and IL17 level, whose collaborative act may orchestrate a proinflammatory microenvironment in the colorectum that may promote carcinogenesis and possibly facilitate progression of CRC
25703059 high levels of IL-33 and a high IL-33/soluble ST2 ratio correlates with elevated levels of IFN-gamma, TNF-alpha and IL-17alpha as well as IL-5, demonstrating that IL-33 has pleiotropic effects.
25693940 Plasma IL-17 was significant elevated in patients with hepatocellular carcinoma compared to healthy control group
25682556 Particularly early after heart transplantation, IL-17-producing CD4(+) T cells home to the graft, which contributes to the AR process.
25680555 the observation that the concentration of IL-17A but not IL-17F was elevated in the sera of patients with colorectal cancer makes this cytokine more likely to be involved in the colorectal cancer pathology.
25649806 IL-23 has a role in disease progression in patients with carotid atherosclerosis, potentially involving IL-17-related mechanisms
25625963 It appears that increased serum levels of IL-17 and especially IL-17F may lead to a raised risk of MS.
25615631 IL-17A haplotypes are involved in the risk of developing premature CAD and some IL-17A polymorphisms are associated with cardiovascular risk factors in Mexican individuals with premature CAD.
25614889 These results confirm the important role of TNF-a in the pathogenesis of nail psoriasis and may suggest that anti-TNF agents could be more beneficial in psoriatic nail disease than agents targeting IL-12/23 p40 or IL-17 .
25596084 individuals with AA genotype of IL-17A rs2275913 were significantly associated with increased risk of cervical cancer in HPV-16- or HPV-18-infected patients when compared with GG genotype, and the OR (95 % CI) was 4.11 (1.14-22.33).
25595174 Our results clearly evidenced the role of IL17A as a novel genetic risk factor for panuveitis, thus suggesting the implication of Th17 cells in the extensive inflammation of the uveal tract that occurs in this subtype of uveitis.
25579009 IL-17A and IL-17F polymorphisms can interact with smoking and drinking to enhance the risk of OSCC developing
25562560 this study is the first to find a clear correlation between high IL-17/IL-23 axis levels and phenotypes of AEDS in children.
25553723 The aim of this study was to analyze the clinical features and expressions of forkhead box P3 (Foxp3) and interleukin-17 (IL-17) in type 1 autoimmune pancreatitis in China.
25549592 increased in patients with atrial fibrillation
25544504 radiation-induced expression in Tregs interferes with the expression of p53 and thereby represses irradiation-triggered apoptosis
25542095 study suggests a linear negative association between IL-17 and diabetic kidney disease (DKD) and a positive association between TGF-beta and DKD
25536226 Letter: report association between serum Il-17 levels and disease duration and parotid gland swelling in primary Sjogren's syndrome.
25525302 IL-23 has a role in regulating IL-17A and/or IL-17F positive Th17 cells in chronic periodontitis
25514475 increased serum levels in patients with allergic rhinitis correlate with the level of allergen-specific IgE
25510225 the -197G > A polymorphism of the IL-17 gene may be considered as a genetic factor of postmenopausal osteoporosis
25500254 IL-17A rs2275913 A/G polymorphism and IL-17F rs763780 C/T polymorphism might be associated with increased gastric cancer risk in Asians.
25499021 Data show that co-culturing with exopolysaccharides from Cyanobacterium aponinum (EPS-Ca) treated dendritic cells (DCs) reduced the IL-17+RORgammat+/IL-10+FoxP3+ ratio in CD4+ T cells.
25484349 IL17RA polymorphisms, but not those of IL17, can influence both the development and the bilaterality of papillary thyroid carcinoma
25484038 Data indicate 3 distinct clonotypes of neutralizing monoclonal antibodies that efficiently neutralized interleukin 17A.
25469655 IL-17A polymorphism was associated with increased susceptibility to non-small cell lung cancer and could affect gene expression.
25445614 A lack of confirmation with alternative assays questions the validity of IL-17A expression in human neutrophils using immunohistochemistry.
25433194 IL-17 may act as chemotropic factor for peripheral blood-Mesenchymal stem cellss by incrementing cell motility and uPA expression during inflammation development.
25429834 the ACA and GCG haplotypes in the IL-17 gene might be a risk factor and a protective marker, respectively, for hepatitis B virus-related hepatocellular carcinoma in a Chinese population.
25427574 Expression of both IL-17A and IL-17 F is increased by the cigarette smoke exposure in explants from both non-COPD and COPD subjects, supporting that local lung cells contribute IL-17 production.
25422215 IL-17A-197G>A polymorphism is associated with elevated digestive cancer susceptibility, both in Asians and Caucasians and especially for gastric cancer.
25413124 results suggest that miR-155 might be involved in the pathogenesis of ITP by regulating cytokine profiles, which may be mediated by miR-155 targeting SOCS1.
25387578 single nucleotide polymorphism affects Rheumatoid Arthritis progression and response to anti-TNF treatment in Polish Patients
25374195 IL-17 gene single nucleotide polymorphism is associated with the risk of developing gastric cancer.
25340344 a model whereby Tax instigates an IL-17RB-NF-kappaB feed-forward autocrine loop that is obligatory for Human T-cell leukemia virus type 1 leukemogenesis
25329073 Treg/IL-17 ratios were normal, the regulatory T cells were still insufficient to suppress the accompanying increases in inflammation.
25323532 IL-17 and IL-35 may be critically involved in the pathogenesis of hepatitis B-related LC.
25308308 In Helicobacter pylori-infected human gastric mucosa, an enhanced expression of IDO is capable of modulating Th1/Th2 and Th17 pathways
25308296 S100A9 and S100A8 may be involved in inducing damage-associated molecular pattern (DAMP)-mediated inflammation in atopic dermatitis triggered by IL-17A and house-dust mites.
25289477 IL-17A polymorphism is associated with increased risk of nonsmall cell lung cancer probably by elevating gene expression.
25288779 IL-17-producing CD4(+) T cells are increased in patients with early active axial spondyloarthritis both with and without MRI abnormalities.
25288569 Two novel gain-of-function mutations of STAT1 responsible for chronic mucocutaneous candidiasis disease: impaired production of IL-17A and IL-22, and the presence of anti-IL-17F autoantibody.
25274569 IL-17A acts synergistically with IFN-gamma to potentiate NO production and leishmanicidal activity in infected macrophages.
25273526 The median IL-17A level was significantly higher in non-diabetic hypertensives with asymptomatic organ damage. There was a positive correlation between mean IL-17A level, and mean microalbuminuria level, carotid IMT and left ventricular mass index.
25257435 Association of 197A allele of IL-17A gene with low myocardial growth and high aerobic performance of athletes was demonstrated
25256120 present a novel signalling mechanism by which IL-17A can induce Egr-1-dependent psoriasin expression via the ERK pathway in keratinocytes
25250801 IL-17A could promote the migration and invasion of cervical cancer cell via up-regulating MMP2 and MMP9 expression, and down-regulating TIMP-1 and TIMP-2 expression via p38/NF-kappaB signal pathway
25241192 These results demonstrate that aptamer-facilitated cell specific delivery of shRNA represents a novel approach for efficient RNAi delivery and is potentially to be developed for therapeutics targeting specific T cells subtypes.
25227691 Polymorphisms in the IL17A gene are associated with recurrent pregnancy loss in Iranian women.
25223230 the A/A genotype in IL-17A was found to predispose to increased atopic dermatitis severity and coexistence of atopic dermatitis and asthma.
25216863 IL17 rs6973569 SNP might be an independent factor of susceptibility to CRC
25210118 The results suggest a novel profibrotic function for IL-17A by enhancing the response of hepatic stellate cells to TGF-beta through activation of the JNK pathway.
25197971 findings indicated that mast cells were the major source of IL-17 in gastric cancer, and intratumor IL-17 infiltration may have promoted tumor progression by enhancing angiogenesis in the tumor microenvironment
25162311 high levels of IL-17 are found in induced sputum and bronchial biopsies obtained from patients with severe asthma.
25149761 Candidemic patients had significantly higher IL-17A.
25138977 IL-17 and IL-22 serum levels in greenhouse workers exposed to pesticides
25136988 IL-17 isoforms are differentially expressed in the dermis of morphea and systemic sclerosis patients.
25136146 IL-17A may have an important role in the development of systemic chronic graft-versus-host disease.
25129403 Th17 cells and Th17-related cytokines (IL-17, IL-21 and IL-22) were increased in the intestinal mucosa in active inflammatory bowel disease patients and may play an important role in disease activity and mucosal damage
25128193 Vitamin D insufficiency may be a predisposing factor in pemphigus vulgaris with dysregulation of TGFB1/Il-17 ratio.
25100151 serum levels of IL-17 and miR-146a were both significantly correlated with clinical activity score (CAS) in Graves' ophthalmopathy (GO)patients; findings indicated that circulating levels of miR-146a and IL-17 may be potential biomarkers of active GO, and may play a key role in the progression of GO
25092442 The objective was to add a piece of information on the role of IL-17 in the genesis of atherosclerosis.
25088788 The relationship between graft rejection and interferon-gamma, interleukin 17, and interleukin 2 levels is reported.
25080350 These findings indicate that Th17/IL-17 response may be involved in central nervous system damage and associated with clinical symptoms in neurosyphilis patients.
25058615 CD146 T-cells produce the majority of Il-17A at the site of active inflammation in psoriasis.
25054133 poststroke depressive symptoms may be associated with cognitive vulnerability to IL-17 related pathways, involving an imbalance between proinflammatory and anti-inflammatory activity and increased oxidative stress
25046339 IL-19 as a component of the IL-23/IL-17 axis strengthens the IL-17A action and might be a biomarker for the activity of this axis in chronic inflammatory disorders
25039885 IL-17 has a role in the innate immune system in pathogenesis of psoriasis [review]
25038189 results indicate that IL-17 stimulates lung tumor growth and regulates MMP-9 mRNA levels in a p53- and SRSF1-dependent manner.
25030504 IL-17A/F is highly expressed by innate immune cells such as neutrophils and mast cells in both acute generalized exanthematous pustulosis and generalized pustular psoriasis.
25028103 IL-17A polymorphisms are associated with increased risk of age-related macular degeneration.
25015721 Interleukin-17 may have a significant role in colorectal cancer
25012243 IL-17 rs2275913 GA, AA genotype, and A allele were associated with an increased gastric cancer risk
25008567 the polymorphism of IL-17A G197A but not C1249T is a risk factor for gastric cancer
24999591 IL-17 has an important role in establishing systemic inflammation in psoriasis and may do so via its effects on monocytes.
24995325 Serum IL-17 and IL-23 levels demonstrate no association with type 1 and type 2 diabetes, but, in line with previous studies, TGF-beta levels were lower in type 1 diabetic patients
24993165 The effect of type 1 diabetes patient's autoantibody profile on peripheral blood mononuclear cell IFN-gamma and IL17 production, was examined.
24990235 FOXP3(+) CD39(+) Treg cells are enriched at the site of inflammation, do not produce proinflammatory cytokines, and are good suppressors of many effector T-cell functions including production of IFN-gamma, TNF, and IL-17F but do not limit IL-17A secretion
24975574 these data suggest a model whereby IL-27 and IL-17A exerts complex reciprocal effects to boost inflammatory responses, but restrain resting cells to prevent inappropriate activation.
24968286 Results indicated that IL-17197 GG genotype, G allele of (rs3819025) and its serum level have predictive values for severity of graft versus host disease.
24965422 present meta-analysis showed the IL- 17A G197A polymorphism is associated with a significantly increased risk for specific forms of cancer, especially in gastric cancer
24962673 IL-17-producing cells may be a useful biomarker for the prognosis of sarcoidosis and play a role in the spontaneous recovery typical of patients with Lofgren's syndrome.
24958901 CCR6+ naive precursors contain a predetermined reservoir to replenish IL-17-secreting cells and may have implications in balancing the Th17 effector and IL-17+ Treg compartments that are perturbed during HIV infection.
24954262 together with TNF-a blocks IL-13 activity via IL-13Ralpha2 induction
24945093 IL-17 upregulated matrix-metalloprotease-9 and neutrophil elastase expression, two proteases involved in blister formation,demonstrating its role in the progress of bullous pemphigoid.
24927491 IL-17A concentration of seminal plasma and follicular fluid in infertile men and women with various clinical diagnoses
24925921 Interleukin-17 cytokine has a role in signaling in asthma [review]
24919524 Endogenous interleukin-6 amplifies interleukin-17 production and corticoid-resistance in peripheral T cells from patients with multiple sclerosis.
24919468 Polymorphisms within the IL17A locus show a novel association with giant cell arteritis.
24916639 The results showed an elevated IL-17 level in bone marrow of myeloma bone disease and skeletal extramedullary disease patients
24899787 Intravenous immunoglobulin therapy downregulated Th17, and Th22 cells and the plasma levels of IL-17 and IL-22 in Guillain-Barre syndrome patients
24899786 the IL-23/IL-17 axis may play a crucial role in the immunopathogenesis pemphigus vulgaris
24893702 Findings indicate that functional interleukin 17A rs3819024 A>G (IL17A) might contribute to gastric cardia adenocarcinoma (GCA) susceptibility.
24887477 Measurement of IL-17 levels might be a useful diagnostic and prognostic test for lung cancer patients with malignant pleural effusion
24861949 Il-6, IL-17, TNF-alpha and VEGF levels were measured in exhaled breath condensate and serum of 15 patients with stage I-IIA non-small cell lung cancer.
24859972 An increased density of intraepithelial IL-17A expressing cells in the CRC-adjacent tissues.
24857622 The genotypic and allelic frequencies of rs2275913 in IL-17A gene were not different between patients with Multiple Sclerosis. and controls
24813240 IL-17(+) regulatory T cells exist in the high-grade glioma tissue; this subset of T cells can suppress CD8(+) T cell activities via releasing TGF-beta and IL-17.
24813051 Our studies support the concept that IL-17A is the major contributor to IL-17-related inflammatory effects in RA.
24788601 results argue in favour of a potential role of IL-17-producing iNKT cells in T1D and suggest that inflammation in T1D patients could induce a Th1/Th17 cytokine secretion profile in iNKT cells promoting disease development
24787050 results suggest that in this experimental model IL-17 and TNF-alpha induced an early alteration of the homeostasis of the inner proliferative layer and of the upper granular layer, as shown by cell proliferation inhibition and occludin expression
24762139 Mid-follicular plasma levels of IL-17, IFN-gamma, TNF-alpha, TGF-beta, IL-6, IL-4, IL-10, SOCS3 and IL-35 were assayed by an enzyme linked immunosorbent assay.
24743018 IL-17A was produced by all monocyte subsets and the expression level was positively associated with LCH disease activity.
24731052 With a cut-off value of 16 pg/ml, IL-17 showed a good diagnostic performance for NSCLC. Multivariate survival analysis indicated that IL-17 was an independent prognostic factor in NSCLC.
24699997 Our result suggests that the A allele of IL17A gene is involved in susceptibility to colorectal cancer and is associated with clinical features
24677375 serum levels of IL-17A were correlated with disease-free survival in patients with circulating tumor cells
24670684 Defective neutrophil recruitment in LAD-I patients or in LFA-1 (CD11a/CD18)-deficient mice--which exhibit the LAD-I periodontal phenotype--was associated with excessive production of predominantly T cell-derived IL-17 in the periodontal tissue.
24664698 This chapter reviews the observed deviation in macrophage plasticity and the elevated expression of interleukin-17 in age related macular degeneration eyes while discussing potential contributions to pathogenesis.
24655820 evidence supports the key role of the interleukin-17A cytokine in psoriasis pathogenesis.
24643836 Phosphorylated STAT3 and PD-1 regulate IL-17 production and IL-23 receptor expression in Mycobacterium tuberculosis infection.
24642072 In the central nervous system, IL-17A has been associated with neuropathology in multiple sclerosis, epilepsy syndromes and ischemic brain injury. Review.
24633013 Th17 cells promote proliferation and invasion and inhibit the apoptosis of human trophoblast cells by secreting IL-17 during the first trimester of pregnancy.
24632587 Serum IL-6 and IL-17 were inversely associated with T2DM retinopathy.
24632586 Based on these findings, significant increase of IL-17 mRNA and protein levels in AR patients highlights the important role of IL-17 in acute liver rejection.
24610014 FIGURE 4. Data indicate that in resolved psoriasis revealed retained IL17 and IL22 expression in epidermal T cells.
24579469 Recombinant hBD-3 can up-regulated the expression of TLR2, IL-17A and IL-22.
24570184 accumulation of intratumoral IL17A-producing cells may promote gastric cancer progression directly or by inducing key signal transduction pathways implicated in gastric carcinogenesis.
24557630 IL-17 induces the migration of neutrophils and monocytes/macrophages through the activation of synoviocytes, and enhances a positive feedback loop composed of proinflammatory cytokines IL-6 and IL-17, but not RANKL
24552849 In peritoneal biopsies from dialyzed patients, IL-17A immunostaining was found mainly in inflammatory areas and was absent in the healthy peritoneum.
24548421 The association of three single-nucleotide polymorphisms (SNPs: -152 G/A, 7488 A/G and 7383 A/G) in the IL-17A and IL-17F genes with lung cancer risk, was investigated.
24534724 IL-17A induced HSP47 expression is involved in collagen I expression in intestinal subepithelial myofibroblasts, which might contribute to intestinal fibrosis in Crohn's disease.
24532300 Expression of IL-17A play an important role in the pathogenesis of liver injury in all of the clinical forms of HBV infection.[Review]
24508995 we describe recent progress on regulation and signaling of IL-17A, and highlight its impacts on lipid metabolism and atherosclerosis--{REVIEW}
24482023 IFN-gamma and IL-17 could have a role in the pathogenesis and progression of lupus nephritis
24447082 11beta-HSD2 expression was decreased in allergic nasal mucosa. In cultured epithelial cells treated with IL-4, IL-5, IL-13, and IL-17A, 11beta-HSD1 expression and activity increased in parallel with the expression levels of CYP11B1 and cortisol
24434314 Several investigators have shown that TGF-b plus IL-6 induced Th17 cells produce IL-17 but do not transfer autoimmunity.
24420723 IL-17A mRNA levels in PBMCs from primary Sjogren's syndrome patients before immunosuppressant treatment were significantly higher than in patients after treatment. IL-17 optical density correlated with lymphocytic infiltration in labial salivary glands.
24412596 CD28 stimulation selectively induces the expression of IL-17A by cooperating with IL-6-mediated signals
24409674 levels of IL-6 and IL-17 were elevated, and the levels of IL-21 were decreased in the acute group. The levels of IL-17 and IL-6 were positively correlated (r = 0.182, p = 0.03), and the levels of IL-17 and IL-21 were negatively correlated
24409666 Age, gender, and duration of diabetes may contribute in the development of T2DM retinopathy while serum level of IL-17 was inversely associated with T2DM and retinopathy
24405842 increased expression in Treg cells from myasthenia gravis patients
24394601 IL17a expression was greater in celiac disease patients' proximal and distal duodenum samples than in controls.
24393079 Single nucleotide polymorphism in IL 17A genes associated with childhood asthma in Tunisia.
24393021 IL-17A mediated modest gene expression response.
24383677 IL-17A level in Cerebrospinal fluid was significantly higher in patients with multiple sclerosis; IL-17A levels were also associated with the neutrophil expansion in Cerebrospinal fluid and blood-brain barrier disruption.
24379648 Interleukin-17 production by T helper 17 cells is increased in patients with birdshot chorioretinopathy, and provides the link between inflammation and immune response in this disease.
24376862 IL-17A induces endothelial inflammation in systemic sclerosis via the ERK signaling pathway.
24363402 Recombinant IL-17A and IL-17F significantly inhibit Fas-induced cell death in Fas-sensitive T cells from healthy donors.
24355795 Patients with Paget's disease of bone presented higher levels of IL6 and reduced IL17, however, there were no significant differences when patients were compared according to disease activity or current treatment.
24352375 IL-17A exacerbates proinflammatory chemokine expression and secretion by human islets exposed to cytokines IL-17A contributes to pathogenesis of IDDM by two mechanisms: the exacerbation of beta cell apoptosis & increased local production of chemokines
24345576 A recombinant human IL-17A (rhIL-17A) variant, yielded four isoforms were obtained when it was refolded.
24340045 in addition to Th17 cells and different innate immune cells B cells also contribute to the IL-17A found in RA patients and healthy controls.
24337660 IL-17A is involved in postmenopausal osteoporosis, playing a role in the bone-resorpting processes.
24323355 Chemotherapy-treated human cancer-associated fibroblasts promote cancer-initiating cell self-renewal and in vivo tumor growth associated with increased secretion of specific cytokines and chemokines, including interleukin-17A
24319050 Serum IL-17 concentrations were significantly higher in patients than in control. In the patient group, the synovial fluid IL-17 concentration increased significantly with KL grade and was significantly positively correlated with Lequesne index
24317395 Neutrophils, but not mast cells, coexpressed the IL-17-associated transcription factor RORgammat and were able to form extracellular traps.
24316750 EIF4E/METAB/CHEM IL-17A is produced by breast cancer TILs and promotes chemoresistance and proliferation through ERK1/2
24315816 The rs2275913 AA and rs3748067 IL-17 genotypes are associated with an increased risk of gastric cancer a Chinese population.
24303990 IL-17+ T cells may cooperate to promote the progression of hepatocellular carcinoma.
24292092 The results showed the increased expression of Foxp3 and IL-17 in lichen planus lesions including oral and cutaneous variants.
24286492 Data indicate that IL-17 secretion was significantly elevated in both psoriatic arthritis (PsA) and psoriasis (Ps), whilst IL-22 secretion was higher in PsA compared to Ps and healthy controls.
24247026 IL-17 contributes to the pathogenesis of primary nephrotic syndrome by inducing podocyte apoptosis.
24236690 The ratio of TGF-beta1/IL-17 is associated with disease progression in patients with HBV-liver cirrhosis.
24223764 Th-17 and IL-17A values were lower in chronic lymphocytic leukemia patients with adverse prognostic factors.
24219883 IL-17 is significantly increased in CSF in sporadic Creutzfeldt-Jakob disease which can be an early event in the pathogenesis of this disease
24218334 The rs2275913G>A and rs763780T>C polymorphisms increase gastric cancer risk, and interact with H. pylori infection and subsites.
24211680 genetic polymorphism is associated with graft outcome after kidney tarnsplantation
24194936 Early local IL-17A production in the airways during respiratory syncytial virus bronchiolitis facilitates neutrophil recruitment with pathologic consequences to infant lungs.
24185279 resident non-lymphoid cells like gingival fibroblasts, gingival epithelial cells, periodontal ligament cells or osteocytes inherently express IL-17A.
24177608 Defective secretion of IL-17 is related to disease acquisition and progression in leprosy patients.
24175805 Serum IL-17A was increased in 30% of glioma patients but in only 4% and 5.5% of meningioma and schwannoma patients and in none of the healthy controls. Higher level of IL17a was correlated with increased age in glioma patients.
24164540 CD49a promoted Con A-induced hepatitis through enhancing inflammatory cytokine production (IFN-gamma and IL-17A) by CD4(+) T and invariant natural killer T cells.
24141678 Considering the inflammatory properties of IL-17A, this study suggests that it could increase susceptibility to atopy and asthma.
24129673 Case Report: IL-17A-producing cells and regulatory T cells in coexistent skin lesions of vitiligo and psoriasis vulgaris.
24128872 Data indicate that the upper 95th percentile reference limit for IL-6, TNF-alpha, and IL17-A was 4.45, 2.53, and 1.93pg/mL, respectively.
24120361 Human IL-17A and IL-17F depend on ACT1 to mediate protective mucocutaneous immunity.
24112799 Compared to normal subjects an 89-fold increase in IL-17A expression was found in palms/soles of patients with PPPP (P = 0.006) and a 190-fold increase for patients with PPP (P = 0.051).
24096234 employed a PCR-SSCP assay to identify the genotypes IL-17A G-197A and IL-17F T7488C. For IL-17A G-197A, there were significant differences in frequencies of genotype and allele of IL-17A G-197A between OA patients and controls
24086143 Since AUBps affect expression of about 8% of the human transcriptome and miR16 is ubiquitously expressed, IL-17 may in addition to inflammation affect many other cellular processes.
24080022 High IL-17 is associated with myelofibrosis.
24076595 these data reveal an increase in the serum IL-17 concentration and IL-17 mRNA expression in children with severe asthma compared to those with mild and moderate forms of the disease.
24072496 The combined detection of IL-17 and CEA may be more valuable in the differential diagnosis between malignant pleural effusions and benign pleural effusions.
24042116 IL-10 regulates an arthritic IL-17 response following infection with B. burgdorferi. these findings provide additional evidence of a role for IL-17 in Lyme arthritis.
24040001 Data indicate that differentially expressed IL-17, IL-22, and IL-23 levels are associated with K-ras in a stage-specific fashion along colorectal cancer progression and an association was established between mutant K-ras and GM-CSF and IFN-gamma.
24039363 Presence of one or more G-197A polymorphisms at position -197 in the promoter region significantly increases gastric cancer risk in an Iranian population.
24032570 The receptor-mediated response by IL-17A significantly up-regulated IL-6 release alone in the non-eosinophilic and eosinophilic groups as compared with the control group.
24021410 Demonstrate increased levels of IL17A in fibromyalgia patients.
23995070 Transgenic NG2-positive glia are identified as the major central nervous system cellular target of IL-17 in experimental autoimmune encephalomyelitis.
23994890 activate the antitumor immune response in esophageal squamous cell carcinoma
23970818 IL-17 may play an essential role in activating and recruiting eosinophils and neutrophils, which ultimately contribute to the tissue damage in dermatitis herpetiformis and bullous pemphigoid
23968496 Serum IL-17 concentration correlates poorly with systemic lupus erythematosus disease activity but is significantly elevated in patients with central nervous system disease
23966065 High serum IL-17A levels are associated with ulcerative colitis.
23965869 IL-17 and TGF-beta1 may be involved in the occurrence and development of asthma, and they play important roles in asthma attack and aggravation.
23957337 CD4(+) IL-17A(+) T cells counts and serum IL-17 levels in conjunction with augmented FeNO levels are systemic markers of childhood asthma, using these markers, prediction and potential therapeutics for persistent asthmatics may be developed.
23957336 Patients with the 'IL-5, IL-17A, IL-25-high' airway inflammatory pattern are often uncontrolled asthmatics, despite daily treatment.
23924903 Our data demonstrate that IL-17 is induced by Propionibacterium acnes and expressed in acne lesions.
23923066 A synergic action was noted between TGF-beta1, IL-4 and IL-17A in terms of induction of bronchial epithelial-mesenchymal transition
23917206 Interleukin (IL)-17 family is a recent classified subset of cytokines, playing critical roles in both acute and chronic inflammatory responses. [review]
23910013 The serum levels of IL-23 and IL-17 in Primary biliary cirrhosis patients were positively correlated with serum gamma-glutamyltransferase levels.
23898208 Inhibition of clathrin-mediated endocytosis by chlorpromazine results in complete inhibition of HIV-1 Tat-mediated IL17 secretion in human primary T cells
23895419 IL17A rs4711998 A>G polymorphism was associated with the decreased risk of esophageal squamous cell carcinoma in a Chinese population.
23888551 It is concluded that IL-8 and IL-17 plays a role in the development of gastric ulcer and gastritis especially in CagA+ H. pylori
23876429 There is no association between the IL17A and IL17F gene polymorphisms and tuberculosis in north Indians.
23857601 IL-17A stimulates the progression of GCTBs and might represent a useful candidate marker for progression and as a therapeutic target for Giant cell tumors of bone
23849453 High IL-17 expression is associated with multiple myeloma.
23842754 IL-17A expression increased in the inflammaorty infiltrate of fibrotic livers from HBV-infected patients with cirrhosis-related early-stage hepatocellular carcinoma compared with nonfibrotic livers from uninfected patients with hepatic hemangioma.
23826419 Show increased expression of IL-17 in the synovial tissue of rheumatoid arthritis patients, the intensity of which is compatible with clinical severity of disease.
23825942 These data provide novel insights into a yet unrecognized mechanism of HBV-induced hepatitis, by which increases in IL-23 expression, through an MR/endocytosis-dependent or -independent manner, produce liver damage through the IL-23/IL-17 axis.
23815507 upregulated serum levels in patients with early inflammatory arthritis
23811547 increased serum levels in Iranian ulcerative colitis patients
23800789 the IL17A and IL17F loci have divergent epigenetic architectures in unstimulated HuT-102 and primary Th17 cells and are poised for preferential expression of IL17A.
23800059 p38 MAPK signalling pathway plays a key role in the TNFalpha- and IL-17A-induced expression of S100A8 in cultured human keratinocytes
23778030 Our results would suggest an association between IL-17A rs2275913 - 152G allele and GG genotype with susceptibility to pulmonary tuberculosis for the first time.
23765637 The constitutive expression of eNOS was unaffected by oxygen concentrations or IL-17 supplementation, whereas both IL-17 and hypoxia upregulated Cox-2 expression.
23765061 Expression of IL-17A in nasal epithelial cells was higher in nasal polyps compared to control mucosa.
23764374 IL-33, induced by IL-17A in epidermal keratinocytes, may be involved in the pathophysiology of inflammatory skin diseases, including psoriasis
23732752 IL-17 and TNF can affect both the growth and pigment production of melanocytes, which may contribute to the pigmentation changes associated with psoriasis
23711712 Evaluated the correlation of chronic periodontitis in tropical area and IFN-gamma, IL-10 and IL-17 levels.
23695682 crystal structures of homodimeric IL-17A and its complex with IL-17RA, are reported.
23692034 CD4(+) T cells producing IL-17, IL-22 and IFN-gamma are important effector cells in the eczematous reactions of nickel-induced allergic contact dermatitis in humans.
23690194 The presence of a significantly higher level of IL-17 in patients with vernal keratoconjunctivitis suggests a possible role of this cytokine in the pathogenesis of vernal keratoconjunctivitis
23683514 PBMC cultures from steroid refractory asthma patients synthesize significantly higher levels of IL-17A than steroid sensitive patients and nonasthmatic control cultures.
23664273 Th1 clones were capable of producing IL-17 upon superantigen stimulation.
23661335 IL-17A, IL-17B, IL-17F and IL-23 in systemic lupus erythematosus patients were examined and the correlation between levels of the investigated cytokines and VEGF, PIGF, as well as number of endothelial cells, was investigated.
23656167 Diagnosis of the higher frequency of the IL-17, IL-21, and IL-23R cytokine genotypes illustrates the importance of Th17-related cytokine genetic patterns in kidney transplant patients with hepatitis B.
23652560 There was a risk haplotype in IL17A associated with increased risk of ulcerative colitis (UC), and the IL17A rs2275913 variant may be a protective factor for UC.
23616636 These findings have established a compelling linkage between activated IL-17-mediated polarization of M1 macrophages and the development of BRONJ-like conditions in both human disease and murine models.
23614810 associated with uterine fibroids in African American women living in the Detroit, Michigan area
23614478 Epistatic interaction between genetic variants in susceptibility gene ETS1 correlates with IL-17 levels in SLE patients.
23613503 IL-17A may play a role in chronic rhinosinusitis pathogenesis and remodeling of nasal polyps.
23596310 data support an unexpected role for IL-17 in orchestrating resolution of innate inflammation.
23555579 When patients were classified according to sputum IgE levels, it appeared that IL-5, IL-6, IL-17 and TNF-alpha sputum supernatant levels were raised in the "IgE high" asthmatics when compared to "IgE low" asthmatics
23555269 We conclude that human pneumococcal carriage can increase the proportion of lung IL-17A-secreting CD4(+) memory T-cells that may enhance innate cellular immunity against pathogenic challenge.
23546988 upregulated gene expression is associated with bone fragility in rheumatoid arthritis patients
23529308 The TIL had a quite positive correlation with PEC IL17
23505558 oxidative stress that is characteristic of HIV disease could contribute to impairments in IL-7 responsiveness and disrupt T cell homeostasis.
23502338 these findings show decreased levels of IL-27 against increasing IL-17A levels in patients group which may suggest a suppressive role of IL-27 on inflammatory process of multiple sclerosis.
23501056 Our data indicates that serum IL-17 levels are significantly increased in intractable Graves disease and affected thyrocytes show functional IL-17R expression.
23490420 These experiments were designed to investigate the effects of IL-17 upon the phenotype and function of human Natural Killer (NK) cells.
23485736 polymorphisms in immune/inflammatory-related genes such as IL-17A rs8193036 and IL-10 1082G/A might be correlated with the risk of PD with cognitive impairment in the Han Chinese population.
23472658 this study indicates that the IL-23/IL-17A axis plays a pivotal role in inflammatory bowel diseases pathogenesis through the NO pathway.
23460603 study provides preliminary evidence of a genetic association between IL1B and IL17A genes and RLS
23451767 results showed high serum levels of IL-17, IL-23 and TNF-alpha among CSU patients which may highlight a functional role of these cytokines in the pathogenesis of this important and common skin disease
23448791 Decreased IL-17 expression in intestinal mucosa of patients with inflammatory bowel disease strongly correlate with endoscopic response and mucosal healing following infliximab therapy
23448394 Suggest that IL-17 may not only induce the inflammation, but also contribute to disease progression and chronicity in hepatitis B infection.
23444260 GKN1 expression induced production of inflammatory cytokines including IL-8 and -17A, but decreased expression of IL-6 and -10.
23421940 IL-17 upregulated the expression of Bcl-2 in fibroblast-like synoviocytes from rheumatoid arthritis patients
23416458 Data indicate that the dose response curve for phorbol 12-myristate 13-acetate (PMA)/Ionomycin differed for IL-10 compared to IL-17 and IFN-gamma production by T4 cells.
23414478 Elevated IL-17A levels in early stages of bladder cancer regardless of smoking status.
23411595 High levels of IL-17 expression in the tumor tissues may be a good prognostic marker for patients with Glioblastoma multiforme.
23409930 Collectively, these data suggest that FoxP3 interacts with RORgammat transcription factor in a viral load-dependent fashion and brings about negative impact on IL-17 production in HIV-1 infection.
23401702 this review is about the role of IL17a in human respiratory diseases and it tries to unravel the question whether IL-17A only provides a link between the adaptive and innate respiratory immunity or whether this cytokine might also be locally produced by innate immune cells.[review]
23400328 cooperative interactions between fibrocytes and Th17 cells play an important role via CD40- and IL-17A/F-mediated signaling for collagen and proangiogenic factor production, which may lead to extracellular matrix deposition and neovascularization
23388330 PD-L1 and PD-L2 expressed on hPMSCs could inhibit the hPMSCs-mediated up-regulation on the expression of IL-17 secreted by peripheral blood T cells
23352235 Human inflammatory dendritic cells, but not inflammatory macrophages, stimulated autologous memory CD4(+) T cells to produce interleukin-17 and induce T helper 17 (Th17) cell differentiation.
23350952 increased serum levels are associated with progression of hepatitis C to hepatocellular carcinoma
23335253 Interleukin-17A+ cell counts are increased in systemic sclerosis skin and their number is inversely correlated with the extent of skin involvement.
23334598 protein levels of IL-17 and IL-17R positively correlated with the frequency of seizures in focal cortical dysplasias patients patients.
23327801 Data suggest that expression of IL17 and RORC (retinoid-related orphan receptor gamma) is up-regulated in mononuclear cells cultured with interleukin-23 but only from subjects with Graves disease; this response is independent of thyroid function.
23323524 The CC genotype of IL17 polymorphism (rs10484879) may contribute to the pathogenesis of peri-implantitis and periodontitis.
23322904 Studies indicate that interleukin-1 (IL-1), IL-6, IL-17, and tumor necrosis factor are critical for the pathogenesis of inflammation in specific brain disorders.
23304063 IL-17A -197A allele is associated with increased risk for chronic periodontitis (CP).
23298391 Studies sugget that the beneficial effect of rituximab on ANCA-associated vasculitis might be due to suppression of IL-17.
23295184 inhibit the extracellular release of IL-23 by macrophages during pulmonary inflammation
23280722 IL17A SNPs were associated with chronic HBV infection and HCC risk possibly through influencing IL-17 production.
23274801 IL-17 appears to be associated with severe DV infection. It is very important to understand the exact role of IL-17 in the pathogenesis of severe DV infection.
23274784 IL-17A but not IL-22 suppresses the replication of hepatitis B virus by inducing the expression of MxA and OAS.
23273903 Levels of IL-17A are significantly decreased in a longitudinal study of multiple sclerosis patients following one year of interferon-beta treatment.
23271701 IL-1-driven IL-17 production plays a critical role in host protective immunity to infection with fungi, bacteria, and certain viruses. (Review)
23269607 Downregulation of IL-17-producing T cells is associated with regulatory T cell expansion and disease progression in chronic lymphocytic leukemia.
23262228 Overexpression of IL-17 and col(V) was detected in obliterative bronchiolitis (OB) lesions in patient lung biopsies and in a murine OB model.
23257917 IL17A serum level is elevated in aspiration pneumonia
23238559 A large burden of neutrophils, neutrophil extracellular traps and IL17A and -F are important constituents of fresh and lytic thrombus after acute myocardial infarction.
23237940 Increased Th17 cells and interleukin-17 contribute to immune activation and disease aggravation in patients with chronic hepatitis B virus infection.
23232337 HIV-induced T helper cell type 1 (Th1), Th2 and Th17 cytokine changes in the sera of treatment naive individuals, were determined.
23227158 patients who suffered from HCC early recurrence had higher pre-therapy serum levels of IL17 and lower levels of IL10 than those who did not suffer from recurrence after curative hepatectomy
23226926 The increased IL-17 level in gingival crevicular fluid (GCF) of generalized aggressive periodontitis (GAgP) suggests a potential role in the aetiopathogenesis.
23226545 Circulating CD161(+)CD4(+) as well as CD161(hi)CD8(+) T cells from transplanted patients secreted high levels of IFNgamma and IL17.
23223131 We observed high percentages of CD8(+) T cells that produced both IL-22 and IL-17 in psoriatic skin lesions.
23215950 A significantly higher frequency of circulating Th17 cells was found in the remission stage of hepatitis B virus-related acute-on-chronic liver failure compared with progression stage, chronic hepatitis B, or normal controls.
23207971 relapsing-remitting multiple sclerosis with high serum IL-17A levels do not respond well to interferon-beta therapy
23204182 High IL-17 expression was associated with better cardiac function, as determined by left ventricular ejection fraction and left ventricular diastolic diameter values in human Chagas disease.
23192273 IL-17A/IL-17RA interaction promoted the metastasis of OS in nude mice.
23181791 Our study demonstrates that eosinophils can enhance the production of IL-17A in activated CD4+ T lymphocytes through the release of IL-1ss.
23158993 CD4, IL-17and Foxp3 may be involved in the tumor suppression caused by host immune response, and are related with non-small cell lung cancer invasion and metastasis.
23148681 Data indicate that CD4+ T cells and fibroblast-like synoviocytes (FLSs) interact with each other by direct contact and cytokine secretion, and amplifies the expression of IL-17 and IL-32.
23147652 Two polymorphisms within the IL17E and IL17RA genes are associated with ESRD independent of age and sex
23137879 No association was found considering the IL17F and IL23R polymorphisms. Our data suggest that IL17A and the presence of IL17A (rs2275913) A allele are associated with the absence of periodontal disease.
23131423 IL-17 rs4711998, rs8193038, rs3748067 AA genotypes and AAGAA haplotype could be considered as susceptibility factors for brucellosis while the inheritance of IL-17 rs3819024GG and rs3819025AA genotypes might be resistance factors against the disease.
23101722 These findings suggest that IL-27, IFN-gamma, and IL-17 play a role in the pathogenesis of Behcet's disease.
23098499 High IL-17 expression is associated with non-small cell lung cancer.
23091305 Data provide preliminary evidence that GBS is associated with high levels of IL-17 and IL-22 in CSF and plasma.
23071273 Results show that basophils selectively augmented the frequency of IL-17+/IFN-gamma- and IL-17+/IFN-gamma+ T cells in TEM and TCM.
23049595 Findings suggested that IL17 gene polymorphism rs2275913 was associated with the susceptibility as well as positive peritumor intravascular cancer emboli and high clinical stage of cervical cancer in Chinese women.
23034167 Quantitative analysis showed high concentrations of IL-10 and IL-17 in pleural fluid and blood of lung cancer patients. Statistical correlation between blood and pleural concentations was proven.
23033269 Higher SOCS3 expression in human T cells favors T helper type 17 cells. Therefore, increased SOCS3 expression in human tuberculosis may reflect polarization toward IL-17-expressing T cells as well as T-cell exhaustion marked by reduced proliferation.
23019580 Data indicate that CpG-DNA methylation and mRNA expression of CREM, IL2, and IL17A of systemic lupus erythematosus (SLE) T cells reflect the effector memory CD4+ T-cell phenotype.
23018031 expression of miR-146a was up-regulated both in lesions and PBMCs of psoriatic patients, and positively correlated with IL-17 expression, whereas the target gene IRAK1 expression was expressed differentially in lesions and peripheral blood.
23012664 Our results provide the evidence that rs2275913 polymorphism is associated with an increased risk for peptic ulcer and the severity of the gastric mucosal atrophy.
23009764 This study aimed to examine interleukin-6 (IL-6), interferon-gamma (IFN-gamma) and interleukin-17A (IL-17A) production in patients with cystic echinococcosis.
22993227 Increased IL-17A expression in temporal artery lesions is a predictor of sustained response to glucocorticoid treatment in patients with giant-cell arteritis.
22989874 Data indicate that the dominance of the SLAMF3/SLAMF6 pathway in inducing IL-17A production can be attributed to an increased nuclear abundance and recruitment of RORgammat to the IL17A promoter.
22989213 The current study has revealed a stepwise increased expression of IL-17A throughout all the stages of colorectal adenoma-carcinoma sequence.
22984500 single nucleotide polymorphisms of IL23R and IL17 are associated with ulcerative colitis risk in a Chinese Han population
22974591 Decreased levels of IL-17 and IL-17/transforming growth factor (TGF)-beta ratio are found in first-episode psychosis patients who are drug-naive, suggesting new aspects of schizophrenia pathophysiology.
22965992 Human aortic tissue demonstrated a significant increase in IL-17 expression in abdominal aortic aneurysm patients compared with control subjects. CD4+ T-cell-produced IL-17 plays a critical role in promoting inflammation during AAA formation.
22960198 synergetic pathways of IL-17A and hypoxia might contribute to the migration and invasion of rheumatoid arthritis synoviocytes by up regulating the expression of MMP2 and MMP9 by activation of the NF-kappaB/HIF-1alpha pathway
22955875 Il-17A SNPs were not associated with psoriatic arthritis susceptibility in northern Italians.
22955700 These results suggest that IL17A polymorphisms (both rs2275913 and rs3748067) influence the susceptibility to and pathophysiological features of ulcerative colitis, coordinately.
22928014 HIV exposure without infection was associated with blunted IL17/IL22 and pro-inflammatory responses
22902077 Letter: Th17 cells and IL-17 participate in the pathogenesis of atopic dermatitis and IL17-G152A A allele confers an increased risk of susceptibility to AD and associates with higher IL-17 expression.
22902060 IL-17A produced by neutrophils stimulates Gro-alpha secretion from endometrial stromal cells, thereby recruiting more neutrophils and inducing perpetuating inflammation in endometriosis.
22880090 Variation of IFNgamma and IFN-gamma/IL-17 responses to mycobacterial antigens exceeds that of responses to the polyclonal stimulus in tuberculin skin test positive healthy humans.
22876724 These findings suggest that IL-17 induced by IL-6 and activated by IL-23 or other IL-17 producing-cells and IL-23 might promote neutrophil activation and muscle damage following prolonged endurance exercise.
22851868 IL-17, IL-23 and PIIINP have an inverse correlation with vitamin D in their involvement in the immune response in patients with HCV-4-related liver diseases in Egypt
22840497 Data indicate that HIV-1 subtype 'C' infection leads to early and enhanced expression of IL-17 and IL-21 producing CD4 T-cells in peripheral blood.
22827846 The inflammation promoting allele of IL17A -197 G>A (rs2275913) and *1249 C>T (rs3748067) was significantly associated with the increased risk for the development of gene mathylations.
22825627 IL-17 enhanced expression of IL-27 in synovial macrophages from rheumatoid arthritis patients and collagen-induced arthritis mice, indicating an interaction between IL-17 and IL-27 as an autoregulatory mechanism
22819243 Data indicate elevated serum IL-17 and tumor necrosis factor (TNF)-like weak inducer of apoptosis (TWEAK) levels in rheumatoid arthritis patients.
22818182 Data show that interleukin-17 and osteopontin are increased in the peripheral blood of patients with chronic hepatitis B (CHB).
22816799 the results indicate that IL-17F/rs763780 polymorphisms may affect the susceptibility to autoimmune thyroid diseases (AITD), and IL-17A/rs3819025 SNP is likely a protective factor to Graves' disease in the Chinese population.
22814515 We confirmed a significant role of IL6, IFNgamma, and IL-17A in the local inflammatory response in sarcoidosis.
22812212 decreased serum levels correlate with symptom improvement after specific immunotherapy in patients with allergic rhinitis
22808218 IL-17A could promote platelet function in patients with acute coronary syndrome via activating platelets ERK2 signaling pathway.
22800829 IL-17 was expressed by tumor-associated macrophages, and IL-17 may significantly correlate to the differentiation and angiogenesis in the development of laryngeal squamous cell carcinoma.
22795370 Patients with cystic fibrosis have inducible IL-17+IL-22+ memory cells in lung draining lymph nodes.
22789685 analysis of the positive link between STAT3 activation and Th17 cell infiltration to the lesional skin in vitiligo vulgaris
22759859 relative gene expression of tumour necrosis factor-alpha (TNF-alpha), interferon-gamma (IFN-gamma) and serum levels of interleukin-17 (IL-17) and IL-23 and their association with SLEDAI (SLE disease activity index) score and organ manifestations in pediatric SLE
22748016 Raised serum IL-17A levels are significantly more common in children with severe autism and may play a pathogenic role in autistic children, compared to healthy controls.
22744708 IL-17 may be involved in the progression of gastric cancer by promoting angiogenesis in tumor microenvironment.
22715389 a differential regulation pattern for genes solely expressed in Th17 cells (IL17A and CCL20) compared to genes expressed in both Th17 and Th1 cells (IL23R and IL12RB2), where high levels of promoter methylation are correlated to near zero
22696687 Systemic sclerosis pathogenesis does not appear to be linked to IL-17-, but rather to IL-22-producing cells with skin-homing potential and a concomitant quantitative Treg defect.
22692973 The Single Nucleotide Polymorphism (SNP) rs2275913 of IL-17A and SNP rs763780 of IL-17F were associated with the development and tumor stage of bladder cancer.
22684574 Our data suggested that Th1 and Th17 cells in the local lesions and peripheral blood may be associated with the pathogenesis of OLP.
22683003 Data show that LPS-induced SIRT1, IL-17, and IL-23 expression and that IL-17 secretion was attenuated by a SIRT1 inhibitor sirtinol pretreatment.
22677045 Activates pathogenic inflammation in subjects with psoriasis.
22660635 MiR-23b suppresses IL-17-, tumor necrosis factor alpha (TNF-alpha)- or IL-1beta-induced NF-kappaB activation and inflammatory cytokine expression by targeting TAB2, TAB3 and IKK-alpha.
22655909 serum level not elevated in patients with chronic heart failure
22647601 observations indicate that human T cells exhibit a sex difference in the production of IFNgamma and IL-17A that may be driven by expressions of PPARalpha and PPARgamma
22641009 Low expression of IL-17A in patients may be a constitutive genetic feature of leprosy patients or a circumstantial event induced by the local presence of the pathogen, as an escape mechanism
22629719 Dynamics of serum IL-17A, IL-17F and IL-23 in patients with inflammatory bowel disease
22627363 NFAT1 and NFAT2 facilitated IL-17A expression in human T cells, though distinct mechanisms might be involved in these effects
22585726 It is speculated that local IL-17 production may be involved during convalescence from respiratory syncytial virus bronchiolitis in non-ventilated patients by facilitating innate and adaptive antiviral immune responses.
22563781 IL-10, IL-17, IL-32 and TGF-beta- producing regulatory B cells.
22559912 These data demonstrate that IL-23/IL-17 axis, stimulated independently of TGF-beta increase IL-17A gene polymorphism and antiphospholipid antibody production, might contribute to vascular manifestations of primary antiphospholipid syndrome.
22541406 These results suggest that IL-17A may partly contribute to the development of nasal allergic inflammation in an animal model and regulate the allergic response via the activation of proinflammatory cytokines and modulation of T(H)2 cytokine.
22537748 genetic polymorphism contributes to gastric cancer risk susceptibility
22534817 Higher levels of IL-17 is associated with the formation of an M2-macrophage-dominant tumor microenvironment in lung cancer.
22532631 IL-17A, specifically when combined with TNFalpha may contribute to the progression of rheumatois arthritis, notably through their effect on synoviocyte aggressiveness.
22527432 IL17A, the hallmark of TH17, was consistently seen before and after treatment, confirming the TH17 subset to be involved in erythema nodosum leprosum
22507625 IL17A and IL17F SNPs, and some intergenic variants have the potential association with allergic rhinitis and comorbid asthma in Chinese population.
22496194 association of IL-17 expression with levels of other inflammatory cytokines and with the clinical course of Duchenne muscular dystrophy suggests a possible pathogenic role of IL-17.
22483685 Our results indicate that the interaction of specific IL17A, interleukin 23 receptor, and STAT4 modulate susceptibility to intestinal Behcet's disease in the Korean population
22466961 IL-17A is a critical factor in increasing IL-8 expression in bacteria-infected cystic fibrosis airways via a pathway that regulates p38 MAP kinase phosphorylation.
22464815 production is induced in memory CD4(+) T cells after cell contact with mesenchymal stem cells, that, in turn, promotes enhanced phagocytic activity of neutrophils
22462422 Serum IL-17 was elevated in rheumatoid arthritis patients, especially in those with anxiety.
22461912 Results suggested that single-nucleotide polymorphisms (SNPs) in IL-17A but not IL-17F were associated with the risk of breast cancer.
22444300 Multivariate analysis revealed that the FOXP3/IL-17 ratio was a significant predictor for kidney allograft outcome.
22442208 these results support a pathogenic role for IL-17 in human ANCA-associated glomerulonephritis.
22419580 Interleukin-17A makes a previously unrecognized contribution to the autoimmune response in autoimmune hemolytic anemia.
22417709 The number of IL-17 producing CD4+ T cells is significantly higher in primary Sjogren's syndrome patients in salivary glands and peripheral mononuclear blood cells.
22395503 IL-17 expression varies in synovium, serum and synovial fluid from treatment-naive, early rheumatoid arthritis patients
22362575 this review article discusses the role of IL-17 in psoriatic disease.[review]
22312940 Of all the SNPs analyzed of IL17A and IL17F, only rs17880588 showed a significant association with asthma in the Saudi population.
22302060 IL-7 and IL-7Ralpha+ T cells were both found to be increased in exocrine glands of Sjogren syndrome patients indicating that IL-7 could contribute to glandular inflammation.
22262980 These results demonstrate an involvement of IL-17/-23 system in the early primary Sjogren's syndrome pathogenesis.
22261033 Cigarette smoke induction of osteopontin (SPP1) mediates T(H)17 inflammation in human and experimental emphysema
22258491 IL-17 specifically when combined with TNFalpha has major pro-coagulant and pro-thrombotic effects on vessels.
22237416 RORgammat repressor isoform, RORgammat-Delta(5-8) may arbitrate IL-17 production in human T cells.
22235998 The mucosal expression of IL-17 transcripts were elevated in untreated celiac disease when compared with the TGA-negative reference children, children with potential CD or gluten-free diet-treated children with CD.
22229441 IL-17A downregulates in keratinocytes the expression of filaggrin and genes important for cellular adhesion, which could affect epidermal barrier formation.
22219320 IL-17 induces the expression of eNOS in human ECs and this may facilitate outward expansion of arteries afflicted with transplant vasculopathy.
22219048 results provide evidence that Th17 cytokines IL-17A and IL-17F have a distinct regulatory role in CXCL1, CXCL5, and CXCL8 expression in lung microvascular endothelial cells stimulated either with IL-1beta or with TNF-alpha
22207110 A correlation between serum levels of IL-17A in multiple myeloma patients and percentage of plasma cells.
22191467 IL-17A production was strikingly low in response to fungal pathogens, in patients with chronic granulomatous disease when compared with healthy controls .
22186234 IL-17 may be involved in the development of nasal polyps through its local immune modulation.
22171994 Using knockdown of AKT & STAT3, studied the effects of IL-17/AKT signaling in HCC, resulting in IL-6 production, which in turn activated JAK2/STAT3 signaling and subsequently up-regulated its downstream targets IL-8, MMP2, and VEGF.
22138182 tristetraprolin bound directly to the IL-17 mRNA 3'UTR and enhanced decay of IL-17 transcripts.
22123380 Findings suggest that the IL-13 -1111C>T and IL-17A -737C>T gene sequence variations might have a role in the development of aspirin-exacerbated respiratory disease.
22123224 These novel findings provide evidence that cytokine-stimulated B lymphocytes could be a significant source of IL-17A and IL-17F and support the notion that these cells actively participate in immune responses via alternative mechanisms in addition to the classic release of antibodies.
22082565 Patients with esophageal cancer have an increased number of il-17 producting t4 cells.
22079540 No significant associations were found among IL-17 genotype and the related cytokine serum levels as risk factor for sepsis development in burned patients
22051182 The distribution, characterization, and generation of CD8+ regulatory T cells and (IL)-17-producing CD8+ T cells in nasopharyngeal carcinoma patients, were investigated.
22048239 Data show IL-22 and CCL20, but not IL-17, expression is elevated in both sera and lesional skin in cutaneous T-cell lymphoma, and suggest that IL-22 may be important in cutaneous T-cell lymphoma, which may prove to be a future therapeutic target.
22042699 Data show that microRNA-135b (miR-135b) mediates nucleophosmin-anaplastic lymphoma kinase (NPM-ALK)-driven oncogenicity and empowers IL-17-producing immunophenotype in anaplastic large cell lymphoma (ALCL).
22035960 A dysregulated T helper cell type (Th)17/CD39-positive regulatory T cell balance may contribute to disease exacerbation in multiple sclerosis patients during disease remission, but not relapse.
22031591 IL-17 may mediate the angiogenesis in a IL-6-Stat3-dependent manner and play an important role in the pathophysiology of hepatic haemangioma.
22028838 the functional relevance of the rs2275913 polymorphism and IL-17 secretion in acute graft-versus-host disease
22026963 IL17A genetic variation is associated with altered susceptibility to Gram-positive infection and 28-day mortality of severe sepsis.
22025620 cAMP-responsive element modulator (CREM)alpha protein induces interleukin 17A expression and mediates epigenetic alterations at the interleukin-17A gene locus in patients with systemic lupus erythematosus.
22020264 found in bronchoalveolar lavage fluid T cells of respiratory patients; a candidate marker of lung pathologies
21998454 IL-1 receptor type I-positive IL-17-secreting cells are highly enriched among central memory regulatory T cells (Treg).
21996293 IL-22 and IL-17A-producing T cells with skin-and lung-homing capabilities are characteristically increased in systemic sclerosis.
21996014 Increased IL-8 (a proinflammatory cytokine) secretion and decreased IL-17 (a protective cytokine of airways) release can both contribute to development of chronic obstructive pulmonary disease.
21994045 Elevated IL-17A levels were positively correlated with IFN-gamma in both inflammatory Crohn's disease and ulcerative colitis
21984702 Epidermal cells contribute a significant proportion of IL-22 and IL-17A mRNA production in the IL-23 injection model of transgenic mouse ear psoriasiform dermatitis.
21982596 In psoriasis patients, gammadelta T cells were greatly increased in affected skin and produced large amounts of IL-17
21980832 upregulated expression in nasal polyposis patients
21977994 Studies indicate that in Th17 cells, activated STAT3 by IL-6 positively regulates H3K4me3 deposition in the Il17 locus.
21972211 Results point to a putative role for Th-17 cells/IL-17A cytokine in the pathogenesis of chronic immune thrombocytopenia.
21968742 Interleukin-17-positive mast cells contribute to synovial inflammation in spondylarthritis.
21966367 Results indicate that four Bifidobacterium bifidum strains showed the highest production of IL-17 as well as a poor secretion of IFNgamma and TNFalpha.
21964025 IL-17 specifically enhances the proinflammatory response in cells infected with respiratory syncytial virus A2 strain.
21960179 REVIEW: the roles of osteoclasts and IL-17 in joint destruction in rheumatoid arthritis
21959034 An increased proportion of IL-21-positive T-cells in systemic lupus erythematosus patients correlates with the proportion of IL-17-positive T-cells.
21949768 The role of the CCL20/CCR6/IL-17 axis in non-small-cell-lung-cancer tumor growth, was investigated.
21949691 Data show that production of IFN-gamma and IL-17A from duodenal biopsy culture was suppressed in hookworm-infected participants, and increased levels of CD4+CD25+Foxp3+ cells in the circulation and mucosa are associated with active celiac disease.
21949023 Programmed cell death 1 ligand 1 (PD-L1) transgene blockade is associated with a switch in T helper (Th) cell balance toward Th17 cells.
21943235 Expression IL-7 and IL-15 genes in prostate tissues and corresponding serum titres are significantly increased in patients with early stage prostate cancer as compared with patients with benign prostatic hyperplasia.
21929599 The increased frequency of peripheral Th17 cells and serum IL-17 levels are shown in childhood Henoch-Schonlein purpura.
21926059 analysis of the imbalance in interleukin-17-producing T and Foxp3+ regulatory T cells in women with idiopathic recurrent pregnancy loss
21911461 These data are consistent with a role for IL-17A in orchestrating the proinflammatory response in trachoma.
21904631 The accumulation of IL-17 expressing cells in proliferative inflammatory atrophy lesions presents direct evidence of an inflammatory microenvironment supporting the development of prostate cancer.
21897004 Serum IP-10 and IL-17 levels after 2 months of anti-TB treatment may be biomarkers for estimating risk of both cavitation and delayed sputum conversion, and for predicting long-term mortality, respectively
21896776 This study demonstrates that IL-23R signaling is needed for B. burgdorferi-induced IL-17 production in vitro and that an IL-23R gene SNP leads to impaired IL-17 production.
21894475 Data demonstrate an early change in sIL-17 during the peri-transplant period after myeloablative allogeneic stem cell transplantation and an association with early leukemia relapse in humans.
21887369 IL-17A expression is localised to several immune cell subtypes within the inflamed synovial tissue. The association of hypoxia with Il-17A expression appears to be indirect.
21872532 IL-17 promoted endothelial-cell production of von Willebrand factor & induced apoptosis by activating caspases 3 & 9, & upregulating the Bax/Bcl-2 ratio. IL-17-induced vascular endothelial damage could play a role in acute coronary syndrome.
21865860 Higher infiltration by Th17 cells compared with regulatory T cells is associated with severe acute T-cell-mediated graft rejection.
21828034 IL-17A induces glucocorticoid insensitivity in airway epithelium, which is probably mediated by PI3K activation and subsequent reduction of HDAC2 activity.
21798287 increases cadherin-11 expression in rheumatoid arthritis
21796151 The data suggested that IL-17A can upregulate keratin-17 expression in keratinocytes in a dose-dependent manner through STAT1- and STAT3-dependent mechanisms.
21795048 IL-17-secreting CD8-positive T cells are increased in patients with neuromyelitis optica (NMO) and multiple sclerosis (MS) during relapse and have an important role in the pathological mechanism of NMO and MS.
21785272 Higher levels of IL-17A were detected in serum of patients with lung adenocarcinoma than healthy controls.IL-17A might affect lung adenocarcinoma by promoting angiogenesis
21781514 The concentrations of SDF-1, IL-17 and the percentage of eosinophils were increased in asthma group compared with control subjects.
21762495 C5a promotes interleukin (IL)-22 and IL-17 expression by human CD4+ T cells.
21761512 Interleukin 17 gene and protein expression are increased in patients with ulcerative colitis.
21760911 IL-17A could upregulate MMP2 and MMP9 expression via NF-kappaB signaling activation.
21755509 IL-17 concentrations were higher in generalized myasthenia gravis patients compared with controls
21752104 intragraft IL-17(+) cell count during acute allograft rejection could have an additional value for predicting late graft dysfunction
21749686 RAGE overexpression in rheumatoid arthritis synovial tissueswas stimulated by IL-17 and IL-1beta.
21746882 Data show the mechanism of 1,25(OH)(2)D(3) repression of IL-17A expression was found to be transcriptional repression, mediated by the vitamin D receptor (VDR).
21741035 ectopic lung B cell formation is important for containment of M. tuberculosis, and up-regulation of IL-17 and IL-22 responses may be an important mechanism underlying the protective role B cells in tuberculosis
21737283 This study provided evidence that the IL-17A-197 G/A and TGFR-beta2-875 A/G genotype is closely related to hemorrhage risk for patients with brain arteriovenous malformation.
21732985 not only the serum IL-17 but also tissue IL-17 are elevated in palmoplantar pustulosis and may be in the pathogenesis of this disorder
21721104 Elevation of IL-17 and IFN-gamma may be an important dysregulation of cellular immunity in pediatric patients with chronic primary immune thrombocytopenia
21710691 IL-17A and RORC gene expression was strongly increased in human gastric biopsies from patients with gastritis, but not gastric cancer
21691744 Suppression of IL-17 by methotrexate may contribute to its potent anti-inflammatory role in rheumatoid arthritis therapy.
21689402 Our data suggest an important role for IL-17 in the inflammatory processes in ankylosing spondyloarthritis.
21685328 Delivery of Notch1 small-interfering (si)RNA to human naive CD4 T cells leads to decreased interleukin (IL)-17 secretion.
21674477 Results show a positive correlation between IL-17-producing cells and B7-H1-expressing Mphis in the same area from HCC tissues.
21672939 Functional variations of the IL-17A gene were associated with susceptibility to inflammatory bowel disease in Koreans.
21659501 Circulating IL-17(+) beta-cell-specific autoreactive CD4 T-cells are a feature of type 1 diabetes diagnosis. We disclose a novel pathway to beta-cell death involving IL-17 and STAT1 and NF-kappaB, rendering this cytokine a novel disease biomarker
21654831 IL-17A+/Foxp3+/CD4+ triple-positive cells were present in skin lesions of patients with severe psoriasis.
21654633 IL-17A antigen is undetectable in Langerhans cell histiocytosis lesion lysates
21651870 Change and significance of Th17 cells and its secretive IL-17 in patients with autoimmune hemolytic anemia
21641076 Our findings suggest that the IL-23/Th17 pathway is expressed in hidradenitis suppurativa and further support involvement of the immune system
21637854 The specific co-regulation of miR-133b and miR-206 with the Il17a/f locus shown in mice also extended to human Th17 cells.
21625016 increased expression in IL-17 and Cox-2 genes in neurophils of patients with vitiligo. This suggested that these two factors are involved in the inflammatory process.
21606249 IL-17-positive mast cells and neutrophils are found at higher densities than IL-17-positive T cells in psoriasis lesions and frequently release IL-17 in the process of forming specialized structures called extracellular traps.
21602493 hypothesize that p300 and DAPK-1 represent nodes where the inflammatory networks of IL-32 and IL-17 overlap, and that these proteins would affect both TNF-R1-dependent and -independent pathways
21573786 Studies indicate the differences between humans and murine gammadelta T cells and underscore the importance of IL-17A- and IL-22-producing gammadelta T cells.
21546069 Results suggest an association of 17q21 polymorphisms with ORMDL3, GSDMA expression, and IL-17 secretion early in life. These observations may imply a functional role of the 17q21 locus affecting T-cell development during immune maturation.
21530504 IL-17/IL-17RA signaling plays an important role in myocardial collagen metabolism in hypertension-induced diastolic dysfunction.
21530487 these results unveil a novel aspect of the inflammatory nature of IL-17A .
21528751 Findings suggest that IL-17 is implicated in systemic lupus erythematosus as well as in discoid lupus erythematosus and subacute lupus immunopathogenesis.
21526159 Th17 cells are key effector T cells that regulate the pathogenesis of autoimmune hepatitis, via induction of MAPK dependent hepatic IL-6 expression.
21524680 Data show that AptAF42 bound IL-17A/F but not IL-17A/A or IL-17F/F.
21521755 role of IL-17A to serve as a modulator of cytokine expression in innate immune response during mycobacterial infection
21518507 The imbalance of T cell subsets in chronic idiopathic thrombocytopenic purpurapatients is mainly associated with IL-12, but not with IL-23 and IL-17.
21505189 Our findings delineate a previously unknown subset of human IL-17(+) Vgamma9Vdelta2 T lymphocytes implicated in the pathophysiology of inflammatory responses during bacterial infections.
21498517 TAK1-c-Rel and IRF4 pathways play distinct roles in the maintenance of IL-9-producing Th17 phenotype of HTLV-1-transformed cells
21478400 This study shows that two major constraints determine the expression of IL-17 by human NKT cells, namely acquisition of an effector phenotype during their development and a proinflammatory environment with TGF-beta, IL-1beta, and IL-23.
21477350 CD8-positive T-cells express IL-17A which may be involved in the pathogenesis of chronic obstructive pulmonary disease.
21474820 There was no correlation between IL17A levels and carotid intima-media thickness in humans.
21455110 RORgammat determined Th17 cell might be involved with increased IL-17A in Behcet's Disease.
21447959 These results indicate a role for IL-17A in the human lung by enhancing the expression of CCL28 and hence driving the recruitment of IgE-secreting B cells.
21440743 interleukin (IL)-10, IL-17, transforming growth factor (TGF)-beta1, and interferon-gamma cytokines have an effect on expression levels of IL-10 and TGF-beta1 genes in renal allograft recipients after donor bone marrow cell infusion
21426710 RORC2 and IL-17 are involved in the inflammatory response of allergic rhinitis and can be used as an indicator to judge the severity.
21396350 these results propose IL-17 as a novel indicator of prognosis in the patients with colorectal carcinoma.
21369705 The expression level of IL-17 mRNA in gastric tumors was associated with the depth of the tumors, lymph-vascular invasion and lymph node involvement.
21357259 Human IL-17-positive Foxp3-positive T cells induce proinflammatory cytokines and suppress T cell function, promoting active inflammation and tumor development through multiple modes of action in the local environment.
21346774 malignant T cells in cutaneous T-cell lymphoma (CTCL) lesions express IL-17 and that this expression is promoted by the Jak3/Stat3 pathway.
21294892 These results indicate that an inherited polymorphism of the IL-4R controls the ability of the human immune system to regulate the magnitude of IL-17 production
21294864 The present study suggests that IL-17 induces negative feedback regulation through the induction of PGE
21292197 local IL-17 production is part of a protective early immune response to peritoneal dialysis related peritonitis.
21282514 TNF-alpha, but not IL-17A, activates NF-kappaB signaling on chemokine CXCL5/endothelial neutrophil-activating peptide (ENA)-78 expression in alveolar type II cells.
21248258 HLA-B27-expressing antigen-presenting cells stimulate the survival, proliferation, and IL-17 production of KIR3DL2-positive CD4 T cells.
21245272 Alpha-toxin induced IL-17A directly in T cells.
21236478 results suggest that therapies inhibiting IL-13 production could have adverse side effects by increasing IL-17A production
21231819 IL-17 and IL-23 levels are increased in early as compared to established disease providing evidence that IL-17/IL-23 may play a crucial role in autoimmune diseases.
21225222 important roles of IL-17 and IL-17-producing cells in the progression of HBV related chronic liver diseases, especially in the formation of liver fibrosis.
21217785 The validation study showed a trend toward an association of the recipient 197A genotype with an increased risk of grades III-IV acute GVHD, as well as a significantly increased risk for chronic GVHD for bone marrow transplantation.
21217016 Unlike gammadelta T cells, T helper (Th)17 cells are found in apposition to osteoclasts in subchondral areas of inflamed joints, a pattern observed in biopsies of rheumatoid arthritis patients.
21204897 In addition to IL-17, we detected IL-6, IL-10, IFN-gamma and TNF-alpha in the synovial T cell line culture supernatants
21196925 Data show that GHRH can stimulate the secretion of IL-17 from human peripheral blood mononuclear cells.
21189442 a twenty-fold increase in the expression of IL-17A mRNA and thirty three-times greater expression of IL-17F in Multiple sclerosis patients compared to the control group
21182094 an excessive IL-17A reactivity towards C. albicans was observed in APS-1 patients and Aire(0/0) mice.
21181220 Inflammatory synovitis in reactive arthritis (ReA)/undifferentiated spondyloarthropathy (uSpA) is mediated by pro-inflammatory cytokines like IL-17, IL-6, IL-1beta, and IL-21.
21178008 Microbiota are required for the generation of both IL-17-positive and Foxp3-positive, retinoic acid-related orphan receptor gamma-positive transgenic T cell subsets in the intestinal lamina propria.
21161669 Our results indicate increased serum IL-17 levels in ankylosing spondylitis patients
21143945 The elevated levels of IL-17 and IL-23 might indicate that Th17 cells are implicated in the persistent neutrophil infiltration in CF lung disease and chronic infection with P. aeruginosa.
21129248 Th17 cells may play important roles in the occurrence and development of acute leukemia through secreting IL-17 and IL-21.
21124836 Data demonstrated that IL-17 was mainly expressed by mast cells and neutrophils and IL-22 by macrophages and dendritic cells.
21116822 may contribute to atherosclerosis und plaque instability
21116820 Although the IL-17A plasma level is not increased in spondyloarthritis (SpA) patients, plasma IL-21 and IL-23 are upregulated in SpA patients, reflecting disease activity compared with healthy volunteers.
21109552 cystic fibrosis patients had a higher level of IL-17 in the lower airway, with the IL-17 localizing to neutrophils and moncytes. IL-17 increased IL-8, IL-6 and granulocyte macrophage colony-stimulating factor production by lung epithelial cell cultures.
21103795 Studies indicate that IL-17 levels increase in obese patients.
21091665 The presence of IL-17(+) FoxP3(+) T cells may play a role in the remodelling of the nasal airways in certain people who develop polyps, irrespective of whether or not they are atopic.
21062626 SNP rs8193037 of IL17A gene is significantly associated with coronary artery disease risk
21062626 Observational study of gene-disease association. (HuGE Navigator)
21062492 Data show that the cytokine IL-17A is increased in the serum and in spinal cord CD8-positive T cells and mast cells of patients with amyotrophic lateral sclerosis, and that SOD-1 may play a role in this inflammation.
21060663 results identify a function for MRE11 in the response to topoisomerase poisons that is distinct from its functions in DSB repair or meiotic DNA processing
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
21044126 H. pylori infection leads to a strong upregulation of both IL-17A and IL-17F in the gastric mucosa suggesting a regulatory link between both genes.
21029245 The proportion of Th17 cells and IL-17A concentrations was both significantly higher in patients with unexplained recurrent spontaneous abortion than in normal early pregnant (NEP) and non-pregnant (NP) patients.
20976193 Early production of IL-22 but not IL-17 by peripheral blood mononuclear cells exposed to live Borrelia burgdorferi.
20974984 During systemic inflammation, STAT1- and T-bet-deficient T cells each exhibit a hyper-T helper type (Th)17 phenotype relative to wild-type controls.
20952660 Colorectal cancer tissue-derived Foxp3+IL-17+ cells have the capacity to induce cancer-initiating cells.
20889558 Results characterize the tissue-based inflammation during secondary syphilis and define IFN-gamma-/IL-17-producing CD8+ T cells as candidate effector cells in pathogen clearance.
20874252 The downregulation of the level of interleukin-17 contributes to the therapeutic effects of IFN-beta in Multiple sclerosis(MS).
20856230 Data suggest that IL17 is an important inflammatory cytokine in salivary gland dysfunction.
20848848 IL-17 and IL-6 levels in chronic hepatitis B patients were significantly higher than those in healthy people.
20840794 MiR-146a is associated with IL-17 expression in peripheral blood mononuclear cells and synovium in rheumatoid arthritis patients.
20825419 Data show that specific IL-17/VEGF-C staining by immunochemistry was observed mainly within the cytoplasm in NSCLC tissue sample.
20814021 T helper type (Th)17 cell-dependent anti-collagen type V immunity is characteristic of atherosclerosis in human coronary artery disease patients and in apolipoprotein E-deficient mice.
20812962 Activated CD4+ T cells can be stimulated by keratinocyte derived Il-1 beta to release high amounts of IL-17.
20810982 The bias toward IL-17-secreting T cells in type 1 diabetes suggests a role for this proinflammatory cytokine in the pathogenesis of disease
20720207 Tregs potently suppress the ability of T helper type (Th)17 cells to proliferate and produce interleukin (IL)-17, IL-22, and chemokine (C-X-C motif) ligand 8, regardless of their capacity to secrete IL-17.
20718783 Data show that plasma concentrations of IL-17A in IVIG-resistant KD were higher in comparison with the sensitive group.
20685755 IL-17 expression can be inhibited by Tregs. The suppressive activity of Tregs on Th17 cells was decreased in patients with unexplained recurrent miscarriage.
20682672 Data show that IL-17 levels are elevated in SLE patients with elevated serum IL-23 in patients with inflammatory manifestations, but lack of correlation between Th17, Th1, and Th2 cytokines suggested independent regulatory mechanisms for these cytokines.
20667562 We report that IL-17 levels are decreased, whereas TGF-beta levels are increased, among Asian Indians with metabolic syndrome
20665551 The findings of this work reveal a significant role for IL-17 in upregulating IVD cell inflammatory mediator release and ICAM-1 and suggest that IFNgamma and TNFalpha act synergistically to elevate an inflammatory phenotype in the presence of IL-17.
20664052 Interleukin-17 T cells are critical to the genesis of myeloma bone disease.
20646637 IL-17 is up-regulated in lung tissues of normal lung function smokers and COPD patients.
20624941 Data show that 5-hydroxytryptophan metabolites inhibit IL-17 production by live C. albicans infection.
20620187 Observational study of gene-disease association. (HuGE Navigator)
20618180 IL-17 levels were significantly increased from first trimester with a mean of 14.61 up to 31.78 pg/mL at third trimester (P < 0.05), but when detectable, they were almost identical range in all trimesters.
20596087 IL-17A+ cells promote IgE production and that IL-17A exerts its pro-allergic effect directly at the level of B cells
20596075 Data show that regulation of interleukin-1beta by interferon-gamma is different in humans and mice, is limited by suppressor of cytokine signalling 1 and influences interleukin-17 production.
20592279 Upregulation of the IL-17 response in type I diabetes (T1D) in children is associated with increased IL-17 secretion, expression/secretion of IL-22, retinoic acid-related orphan receptor C isoform 2 (ROTC2), and FOXP3 messenger RNA transcripts.
20581151 IL-17-producing CD8-positive T cells are generated by an intriguing mechanism and constitute a remarkable portion of IL-17-positive cells in human hepatocellular carcinomas.
20563617 analysis of the imbalance between regulatory and IL-17-secreting CD4+ T cells in lupus patients
20533542 Endogenous Osteopontin produced in Rheumatoid Arthritis Synovial Fluid was responsible for markedly increased production of IL-17 in T cells
20515574 Increased serum IL-17 is associated with medulloblastoma.
20511558 The hallmark T helper cell type (Th)1 cytokine IFN-gamma can also be defined as a T helper type (Th)17 cytokine, depending on the milieu and other cytokines produced by patients' T cell subsets in peripheral blood and inflamed tissues.
20511548 Interferon-gamma and tumor necrosis factor-alpha synergistically enhance expression of CD54 by mesenchymal stem cells, enabling CCR6 chemokine ligand CCL20 to induce adhesion of cultured IL-17-expressing T helper (Th)17 cells to mesenchymal stem cells.
20506642 IL-17 plays an important role in the development of nasal polyps, but in patients with allergic rhinitis, there was only apparent expression of IL-17 in nasal mucosa.
20503287 Observational study of gene-disease association. (HuGE Navigator)
20493423 IL-17 isoforms (IL-17A and IL-17F) are implicated in systemic lupus erythematosus but also in discoid and subacute lupus erythematosus immunopathogenesis
20445554 role in inflammation in acute Behcet's disease in T-lymphocytes
20437253 IL-17 SNP rs2275913 was associated with several asthma-related traits and confers genetic susceptibility to childhood asthma
20437253 Observational study of gene-disease association. (HuGE Navigator)
20418110 Observational study of gene-disease association. (HuGE Navigator)
20395418 IL-17 promotes myeloma cell growth and colony formation via IL-17 receptor, adhesion to bone marrow stromal cells as well as increased growth in vivo in murine xenograft model of human multiple myeloma.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20357258 IL-17 efficiently amplifies the allergic reaction in contact dermatitis patients by rendering virtually all of the T lymphocytes recruited at the site of skin inflammation capable of directly contributing to tissue damage.
20357253 Although T helper type (Th)17 cells are not necessary for chronic rejection, their presence within the kidney graft correlates with a faster progression of the destruction process.
20352428 Studies provide information regarding IL-17 and Th17 cells in cancer and their potential roles in cancer development.
20350814 IL-17 was significantly elevated in cerebrospinal fluid with bacterial meningitis.
20339909 evidence that IL-17 can stimulate macrophage phagocytosis of apoptotic neutrophils and particles as well as inducing neutrophil apoptosis
20334681 IL-17 blocking may offer a therapeutic target in systemic lupus erythematosus.
20306850 The eosinophilic cell count was correlated with the amount of IL-17 positive cells in nasal polyps and with allergic rhinitis.
20305686 Recent findings on the role of Th17 cells and their associated cytokines (IL-17 and IL-22) in the pathogenesis of liver diseases, are summarized.
20299682 the MTB-induced IL-17A response relies strongly on the endogenous IL-1 pathway and IL-1R signaling. TLR4 and dectin-1 are the main receptors responsible for mediating the signals responsible for IL-17A production by MTB.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20228201 In contrast to Saccharomyces cerevisiae yeast cell-induced T helper cell type (Th)1 response, dendritic cells exposed to spores or Candida albicans hyphae induce cellular responses shifted toward differention into T helper IL-17-producing (Th17) cells.
20228199 Monocyte migration is an important mechanism by which IL-17 contributes to chronic inflammation, as observed in patients with rheumatoid arthritis.
20228195 IL-17 is a potent activator of the endothelium in vivo leading to neutrophil infiltration of the airways in chronic airway disease.
20207161 The onset of sepsis is related to differential TGFbeta-1 and IL-17 gene expression.
20200272 mast cells may be an important component of the effector IL-17A response in rheumatoid arthritis
20185422 IL-17-producing Th cells are present, and IL-17, as well as other Th17-associated cytokines, is involved in the immunological response to endotoxin in human airways
20173782 Observational study of gene-disease association. (HuGE Navigator)
20173024 IL-17 and its receptor IL-17RC are involved in rheumatoid arthritis synovial fluid-mediated chemotaxis in human lung microvascular endothelial cell culture.
20167120 IL-17A upregulates the receptor activator for NF-kappaB receptor on human osteoclast precursors in vitro
20159251 p-STAT3 levels are decreased in chronic rhinosinusitis with nasal polyps despite increased levels of IL-6 and sIL-6R and are associated with the absence of an IL-17 response
20127054 Results suggest that genetic polymorphisms of IL-17A and MIF, but not IL-17F, are associated with CpG island hyper-methylation status in gastric cancer.
20112373 novel immunoregulatory role of TNFalpha on Th17 and Treg cells in some individuals, which may account for the exacerbation of skin inflammation in some patients who receive anti-TNF treatments
20107878 significantly elevated and correlated with diseases activity in systemic lupus erythematosus patients
20106535 higher expression in peripheral blood lymphocytes and decidua of recurrent spontaneous abortion patients
20099977 High serum Interleukin-17 levels rae associated with colorectal carcinoma.
20070409 TLR6 plays a pivotal role in the development and severity of hypersensitivity pneumonitis via its role in IL-17A production.
20061410 Expression of IL-17A RNA and protein is more pronounced in active celiac disease (CD) biopsy specimens in comparison with inactive CD and normal mucosal biopsy specimens and is produced by cells that also make interferon-gamma.
20042592 The 3' untranslated region of CXCL1 contains an AUUUA-free segment that provides tristetraprolin-independent instability, which can be markedly stabilized in response to stimulation with IL-17.
20032993 IL-17A+IFN-gamma-, IL-17A+IL-22+IFN-gamma-, and IL-17A+IL-22-IFN-gamma- cells were increased in psoriatics
20026744 The differentiation of IL-17-producing (Th17) cells from naive T cells and the amplification of Th17 effector functions of memory T cells are promoted by plasmacytoid dendritic cells after Toll-like receptor 7 activation.
20026736 Identification of potential mechanisms for accumulation and regulation of T helper type (Th)17 cells in tumor microenvironments provides the foundation for further studies of the role of Th17 cells in antitumor immunity.
20022135 an independent prognostic factor for survival in non-small cell lung cancer patients
20016509 Studies indicate that modulation of TH-17 cell function and/or differentiation has proceeded to the greatest extent with monoclonal antibodies to IL-12 p40.
19969371 These results indicate that IL-17, produced by T cells, promotes inflammation at the fetomaternal interface in preterm delivery.
19968632 IL-17A and IL-25 had opposing effects on thymic stromal lymphopoietin regulation in human nasal epithelial cells
19940509 Duodenal mucosal expression of IL-17A was significantly increased in celiac disease but not in gluten sensitivity patients, compared to controls.
19936899 elevated expression in the mucosa of inflammatory bowel disease patients
19931506 innate immune response to pathogens in airway epithelial cells lacking functional CFTR is further enhanced by IL-17 through the up-regulation of pattern recognition receptors.
19929695 interleukin 17 and interleukin 23 were statistically significantly decreased in tuberculin skin test(TST)-positive individuals, compared with TST-negative individuals
19917178 a positive correlation was found between levels of Interferon-gamma and Interleukin 17 in synovial fluid of C. trachomitis reactive arthritis patients
19912252 Studies indicate that Th17 cells have been identified recently as a Th lineage that regulates inflammation via production of distinct cytokine interleukin (IL)-17.
19912251 Studies indicate that T(regs) and Th17 cells arise from common precursors.
19912249 Studies indicate that the classical T helper (Th) 1 and Th2 subsets have been joined recently by the Th17 lineage.
19912248 Studies indicate that many similarities exist between human and mouse Th17 cells.
19907660 the IL-17/IL-6 axis has a role in inflammation in tumor-like stem cells derived from human keloid
19904747 Observational study of gene-disease association. (HuGE Navigator)
19895848 higher production in synovia cells from rheumatoid arthritis patients
19878510 defective IL-17 production in response to specific pathogens can differ between patients with hyperimmunoglobulin E syndrome and that the extent of the defective Th17 response determines their clinical phenotype
19861249 IL-17 levels were significantly elevated in PBMCs from dilated cardiomyopathy patients as compared with those in non-DCM patients and normal control subjects.
19857751 Immunosuppressive drugs used in the clinic may differentially influence lymphocyte polarization, including the newly identified il-17 secreting T cells.
19844129 plasma concentrations increase with the severity of allergic asthma
19843935 A subset of human and mouse CD4-positive T cells as well as human T helper (Th)17 T cell clones express interleukin-17A on their surface upon stimulation.
19838198 IL-17RA used a common recognition strategy to bind to several members of the IL-17 family, which allows it to potentially act as a shared receptor in multiple different signaling complexes.
19835883 The epitope recognized by the CAT-2200 monoclonal antibody is shown to involve 12 amino acid residues from the quaternary structure of IL-17A, with each Fab contacting both monomers in the dimer.
19830738 Data show that in lesional skin of psoriasis patients, highly elevated IL-20 levels strongly correlated with IL-22, and to a lesser extent, with IL-17A and TNF-alpha.
19825828 Act1 mediates IL-17-induced signaling pathways through its E3 ubiquitin ligase activity and TRAF6 is a critical substrate of Act1, which indicates the importance of protein ubiquitination in the IL-17-dependent inflammatory response
19822653 These results suggest that superantigenic Staphylococcus aureus are particularly efficient in stimulating IL-17 production and that the cytokine is produced from memory T cells.
19797506 Results desceibe the gene expression of interleukins-17A, -23, and -12 and determine the proximity of IL-17A- and IL-23-producing cells in rheumatoid synovial tissue.
19748982 This study reports a significant although modest increase in the frequency of IL-17-secreting cells in lymphocytes from long-term patients with type 1 diabetes compared with healthy controls.
19741298 Data suggest that chronic production of TNF-alpha in the tumor microenvironment increases myeloid cell recruitment in a TNFR1 and IL-17-dependent manner that contributes to the tumor-promoting action of this proinflammatory cytokine.
19741026 findings suggest a novel immunopathological role of Th17 cells and basophils in allergic asthma through the activation of granulocyte-mediated inflammation initiated by the direct interaction between basophils and bronchial epithelial cells
19737863 overexpression of SOCS3 in T cells reduces IL-17 and accelerates atherosclerosis.
19728295 IL-17 induces osteoclastogenesis from human monocytes alone in the absence of osteoblasts, which is potently inhibited by anti-TNF-alpha antibody
19724898 No association were found between CpG island hyper-methylati status and L-17A (-197G>A), IL-17F (7488T>C) and MIF (-173G>C) polymorphism.
19724898 Observational study of gene-disease association. (HuGE Navigator)
19700754 a profusion of IL-17-generating cells and supporting cytokines within primary Sjogren's syndrome
19692128 A spectrum of phenotypes is discernable within the group of RORgammat positive/T-betpositive cells, including those that phenotypically resemble Th1 cells, to Th1/Th17 cells, to Th1/Th17 whose IL-17 production is variable.
19672092 IL-17A plays an important role in the eosinophil accumulation in the nasal polyps and the remodeling of the nasal polyps of chronic rhinosinusitis associated with asthma.
19628296 IL-17 regulates differentially chemokine and matrix metalloproteinase expression by normal and transformed fibroblasts and is indirectly capable of attracting both monocytes and neutrophils to the inflammatory focus.
19627579 Human rheumatoid arthritis tissue production of IL-17A drives matrix and cartilage degradation: synergy with tumor necrosis factor-alpha, Oncostatin M and response to biologic therapies.
19620772 IL-17 and IL-22 play complementary roles in human protection against Kala Azar, and that a defect in Th17 induction may increase the risk of Kala Azar.
19589271 Plasma MPO and IL-17 levels were significantly elevated in acute coronary syndromes patients compared with the patients with stable angina and the healthy control subjects.
19587005 binding of NKG2D to UL-16 binding protein (ULB)1 contributes to IL-23-dependent IL-17 production by CD4(+) cells in human M. tuberculosis infection.
19566585 increased expression in children with allergic rhinitis during sublingual immunotherapy
19550095 cannot be considered as a biomarker of periodontal disease progression [since] levels in gingival crevicular fluid were nearly zero
19545679 IL-17 may be an important marker in the pathophysiology of acute kidney rejection.
19543237 Interleukin-17 can function as a signal to induce extensive bone turnover by regulating Mesenchymal Stem Cells recruitment, proliferation, motility, and differentiation.
19536281 IL-17, IFNgamma and TGFbeta levels in CD45Ro and CD45Ra cells from systemic sclerosis patients are differently expressed in lSSc, ldSSc or edSSc phenotypes
19535626 Transforming growth factor(TGF)-beta promotion of IL-17-producing T helper (Th17) cell development can inhibit suppressor of cytokine signaling SOCS3, thus enhancing signal transducer and activator of transcription STAT3 activation.
19487306 Thus, CD8+IL-17+ T cells share some key features with Th17 cells and exhibit remarkable differential abilities attributable to the CD8+ lineage of T lymphocytes.
19485773 The IL-17 levels were significantly higher in scrub typhus patients than in the healthy group
19479869 The frequencies of IL-17-positive and IL-22-positive CD4+ T cells were increased in peripheral blood mononuclear cells from patients with ankylosing spondylitis and patients with rheumatoid arthritis.
19479806 IL-23 and IL-17 are up-regulated during acute hepatic rejection after liver transplantation.
19476435 Role of IL-17 in the pathogenesis of the inflammatory reaction in leishmaniasis
19476112 The ability to express IL-17 protein or mRNA in PBMC is abnormal and the change strongly correlates with the heart function of DCM patients.
19457169 IL-17A and Th17 lymphocytes are involved in the immune pathogenesis of Alzheimer Disease.
19439651 human memory Tregs secrete IL-17 ex vivo and constitutively express RORgamma t
19431078 [Review] Review of results from studies using different arthritis models have demonstrated that IL-17-producing T-cells are the dominant cell type in the development of arthritis.
19428338 IL-17A plays a regulatory role in both the metabolic and inflammatory processes of human adipocytes
19426392 Association of the CagA status of Helicobacter pylori and serum levels of interleukin (IL)-17 and IL-23 in duodenal ulcer patients.
19424201 This study does not support a central role for IL-17A in the pathogenesis of Langerhans cell histiocytosis.
19414056 Results show that G-197A polymorphism of IL-17A gene was significantly associated with the development of gastric cancer, especially intestinal-type cancer.
19414056 Observational study of gene-disease association. (HuGE Navigator)
19404732 IL-17-induced MMP-9 expression was via p38 MAPK and ERK1/2 dependent NF-kappaB and AP-1 activation.
19347604 These results indicate increased serum IL-17 levels in systemic lupus erythematosus patients.
19343046 Observational study of gene-disease association. (HuGE Navigator)
19339380 IL-23/IL-17 pathway significantly contributes to renal tissue injury in experimental glomerulonephritis in mice.
19333939 Our findings indicate that overexpression of IL-23, but not IL-17, is a pivotal feature of subclinical gut inflammation in ankylosing spondylitis
19329213 Intratumoral IL-17-producing cell could serve as a potential prognostic marker and a novel therapeutic target for hepatocellular carcinoma.
19325128 different pathways may be utilized for the generation of Th17 responses in situ depending on the site or route of accessory cell activation
19322214 The IL-23/Th17 axis has a role in the immunopathogenesis of psoriasis [review]
19295614 Th17 cytokines stimulate CCL20 production in vitro and in vivo, and thus provide a potential explanation of how CCR6-positive Th17 cells maintain their continual presence in psoriasis through a positive chemotactic feedback loop.
19273860 IL-17-producing Treg cells may play critical roles in antimicrobial defense, while controlling autoimmunity and inflammation.
19265168 Monocyte migration is mediated by a direct effect of IL-17 on monocytes; IL-17 is chemotactic for monocytes at concentrations detected in synovial fluid from rheumatoid arthritis patients.
19265112 IL-17A induces gene expression via the signal transducer and activator of transcription 3 (STAT3) pathway in human airway smooth muscle cells.
19260856 role in progesterone secretion by choriocarcinoma cell line
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19255340 IL-17 interacted cooperatively with IFN-gamma to enhance IL-6, CXCL8, and CXCL10 secretion in T-cells, infiltrating atherosclerotic coronary arteries.
19247658 IL-23 and IL-17 may play critical roles in the pathogenesis of ankylosing spondylitis and IL-23-stimulated production of IL-17 by PBMCs may be responsible for the development of AS.
19244159 stage 3 immature natural killer cells are highly enriched for IL-22 and IL-26 messenger RNA, and IL-22 protein production, but do not express IL-17A or IL-17F
19242409 IL-17 has a role in corneal epithelial barrier disruption in DE.
19240794 5 nights of sleep restriction increased lymphocyte activation and the production of proinflammatory cytokines including IL-1beta IL-6 and IL-17
19239321 role of IL-17 family cytokines, not only as markers of the inflammatory process but also as indicators of leukocyte activity in IL-17A and IL-17E-dependent reactions in patients with oral epithelial squamous cell carcinoma.
19235914 significant association between Crohn disease and the widely replicated IL23R variants is only seen in the presence of IL17A or IL17RA variants
19234216 Unexpectedly, proinflammatory IL-17 displays anti-inflammatory activity during suppression of disease development in autoimmune uveitis-susceptible Lewis rats and C57BL/B10RIII mice treated with various doses of recombinant human IL-17.
19226302 serum IL-17 level assessment might be considered to classify allergy severity.
19210369 The results indicated an independent role of IL17A promoter polymorphism rs8193036 in the association with pediatric asthma in Taiwanese population.
19210369 Observational study of gene-disease association. (HuGE Navigator)
19208686 Observational study of gene-disease association. (HuGE Navigator)
19201028 Fibroblast-like synoviocytes are potently regulated by inflammatory cytokines to specifically express IL-23 p19.
19199539 The functional roles of interleukin-17, SLAM and CREB on IFN-gamma production in persons with tuberculosis are reported.
19187277 no significant different expression of IL-17 transcripts between chronic ITP patients and controls
19177575 In alcoholic hepatitis, liver infiltration with IL-17-secreting cell infiltrates is a key feature that might contribute to liver neutrophil recruitment.
19174010 IL-17 is obviously increased in HBV related liver diseases, especially in hepatitis B related liver cirrhosis, indicating that IL-17 may play a part in the development of HBV related liver diseases.
19131064 Interleukin 17 has a role in acute coronary syndrome
19127457 Il-17 production occurs in intestinal biopsies of Celiac disease patients in response to gliadin.
19124735 Skin-migratory dendritic cells stimulate allogeneic naive CD4+ T cells that differentiate simultaneously into two distinct effector T helper (Th)17 and Th1 populations capable of homing to the skin, where they induce severe cutaneous damage.
19079215 Despite persistent CD4+ T-cell proviral burden and residual immune activation in GALT during HAART, effective CD4+ T-cell restoration (>50%) was achieved, which was associated with enhanced Th17 CD4+ T-cell accumulation
19075290 Data suggest that graft-derived IL-1 can promote T cell intimal recruitment and IL-17 production during human artery allograft rejection, and suggest that targeting IL-1 in the perioperative transplant period may modulate host alloreactivity.
19056110 The ineffective IL-17-dependent upregulation of HBD-2 in patients with AE is due to a partial inhibition by the type 2 microenvironment, which could partially explain why patients with AE do not clear S aureus.
19050297 IL-17 production is increased in systemic lupus erythematosus patients due to the expansion of the proinflammatory double negative T cell subset and to excessive IL-17 production of CD4-positive T cells.
19050268 IL-17A enhances cathelicidin expression in keratinocytes through activation of Act1, an adaptor protein involved in IL-17A signaling, and a Map kinase-ERK kinase-dependent mechanism.
19014637 High macrophage IL-17 expression is associated with breast cancer invasiveness.
18992745 RORgamma controls IL-17A and IL-17F production, and these cytokines have a redundant but highly pathogenic role in gut inflammation.
18941244 In cultured tumor cells, IL-17 strongly represses tumor necrosis factor-alpha-stimulated expression of chemokines CXCL10, CXCL11 and CCL5, but synergizes with TNF-alpha for induction of CXCL8, CXCL1 and CCL20 mRNAs.
18941201 IL-17 expression is increased in human asthmatic alveolar macrophages, but not IL-17-positive interstitial macrophages, after allergen challenge.
18941172 In the presence of antigen-presenting cells, T helper cell interleukin (IL)-17 production is enhanced by IL-1 and IL-23.
18926293 IFNalpha down-regulates IL-17 expression and Th17 differentiation in vitro and in vivo.
18832156 regulation of human CD4+ IL-17-producing T cells in ovarian cancer.
18802458 IL-17A increased pneumococcal killing by human neutrophils both in the absence and in the presence of antibodies and complement
18802076 Prevalence, phenotype and distribution of IL-17-expressing T cells is demonstrated in the skin of psoriasis patients, revealing that psoriatic skin contains abundant IL-17-positive T cells including T helper (Th)17 cells and CD8+ IL-17-expressing T cells.
18793860 Our data suggest that IL17 might play a crucial role mainly in the early phase of MS, while IFNgamma seems to be involved both in the early phase and in the following relapses of the disease.
18786233 The role of the IL23/IL17 axis in bronchiolitis obliterans syndrome after lung transplantation is reported.
18769923 These findings suggest that IL-17 gene SNPs may influence the susceptibility of Behcet disease.
18684981 Th17-secreting cells detected in the salivary glands of Sjogren's syndrome (SS) patients are associated with the pathogenesis of SS in the salivary glands.
18684971 Human IL-17F/IL-17A heterodimer can bind and signal through the same receptor complex as homodimeric cytokines IL-17F and IL-17A.
18669891 These data demonstrate the capacity of dendritic cells (DCs) to induce expansion of polyfunctional IL17-producing T cells in humans, and suggest a role for DCs in the enrichment of Th17-1 cells in the tumor bed.
18663128 all IL-17-producing cells originate from CD161(+) naive CD4(+) T cells of umbilical cord blood, as well as of the postnatal thymus
18617638 regulatory T cells (CD4(pos)CD25(high)Foxp3(pos)CD127(neg)CD27(pos)) can differentiate into IL-17-producing cells, when stimulated by allogeneic antigen-presenting cells, especially monocytes, in the presence of rhIL-2/rhIL-15.
18615114 Peripheral blood mononuclear cells from immunocompetent Candida-infected patients secreted more IL-17 and IL-22 than those of both chronic mucocutaneous candidiasis patients and healthy, non-infected controls.
18602680 this study provides the first evidence that serum IL-17 levels might be increased in patients monosensitized to birch with the most severe allergic rhinitis. Thus increased IL-17 serum levels can be considered a marker of severe allergy.
18600325 No significant differences of IL-17 concentration were observed between patients with active immune thrombocytopenic purpura and the control group
18591412 IL-12Rbeta1- and STAT-3--dependent signals play a key role in the differentiation and/or expansion of human IL-17-producing T cell populations in vivo.
18591410 a failure of CD4+ T cells harboring heterozygous STAT3 mutations to generate interleukin 17-secreting cells due to a failure to express sufficient levels of the Th17-specific transcriptional regulator retinoid-related orphan receptor t.
18588867 The expression level of IL-17A was significant difference in expression between gingivitis and periodontitis .
18585926 multiple myeloma patients without osteonecrosis of the jaw and control subjects presented similar values of IL-17 serum levels
18579762 Levels of IL-23, IL-17, and IFN-gamma are elevated in Behcet disease(BD) with active uveitis. IL-23/IL-17 pathway together with IFN-gamma is associated with active intraocular inflammation in BD patients.
18512780 IL-17 family members are varyingly expressed in rheumatoid nodules. The paucity of IL-17A in nodules suggests an important difference from that observed in the synovium
18501882 Results show that the OX40-OX40L interaction suppresses IL-17 production by PHA-stimulated human PBMC and purified CD4 and CD8 cells.
18483277 tumor-induced TGF-beta may actively subvert the CD8+ arm of the immune system into directly promoting tumor growth by an IL-17-dependent mechanism
18446062 IL-17 and TLR2 ligands stimulate the production of IL-16 by rheumatoid arthritis fibroblast-like synoviocytes
18440075 some memory Th-17 cells might play an important role in the defense against the infections of fungi such as C. albicans
18434325 Foxp3 inhibits RORgammat-mediated IL-17A mRNA transcription through direct interaction with RORgammat
18432274 The number of Th17 cells is increased in the peripheral blood and acute lesional skin of atopic dermatitis. Th17 cells may exaggerate atopic eczema.
18400187 Review highlights the developmental pathways shared by new lineage, IL-17-producing CD4+ T helper (Th17) cells and regulatory T cell subsets during the pathogenesis or control of inflammation.
18392953 High levels of IL-1beta, IL-10, IL-17 and TNF-alpha (in the serum and synovial fluid) were observed in arthritis compared to the healthy controls.
18373953 The activated IL-23/IL-17 axis is important for the inflammatory immunity in systemic lupus erythematosus.
18362142 the NF-kappaB binding cofactor, IkappaB-zeta, was up-regulated by IL-17A, and the knockdown of IkappaB-zeta significantly diminished the IL-17A-induced hBD-2 expression.
18337720 data suggest that the inability to produce T(H)17 cells is a mechanism underlying the susceptibility to the recurrent infections commonly seen in autosomal dominant hyper-IgE syndrome
18329249 Il-17 may be involved in autoimmune responses in systemic sclerosis
18311821 Proinflammatory cells in juvenile idiopathic arthritis contribute to joint pathology, as indicated by relationships with clinical phenotypes, and that the balance between IL-17+ T cells and Treg cells may be critical to outcome.
18311793 Immunohistochemical stainings of submandibular glands from C57BL/6.NOD-Aec1Aec2 mice and of salivary gland biopsy specimens from Sjogren's syndrome patients revealed IL-17 and IL-23 staining within lymphocytic foci and epithelial tissues.
18203309 Interleukin 17 levels are increased in juvenile idiopathic arthritis synovial fluid and induce synovial fibroblasts to produce proinflammatory cytokines and matrix metalloproteinases
18157139 analysis of an IL-17A-dependent pathway of dendritic cell fusion in langerhans cell histiocytosis
18156204 there is an enrichment of both IL-17+CD4+ and CD8+ T cells in active multiple sclerosis lesions
18097022 All IL-17-producing CD4+ T cells expressed CCR6, a receptor found on approximately 50% of CD4+ memory peripheral blood leukocytes.
18092129 IL-17 gene expression in synovial tissues of Rheumatoid arthritis (RA) was similar to that in Osteoarthritis; expression level in peripheral blood monouclear cells of RA was significantly higher than controls
18079209 IL-17A enhances the expression of cyclooxygensase-2 and IL-8 and the proliferation of endometriotic stromal cells. IL-17A may play a role in the development of endometriosis.
18075825 Il-17 producing T cells are important in mucosal host defense, in the setting of retained antigenic stimulation, such as in asthma, chronic infection, and cystic fibrosis, or in the setting of autoimmunity, these cells can mediate immunopathology [review]
17982039 two independent and indispensable signaling pathways-1) JAK1-associated PI3K signaling and 2) Act1/TRAF6/TAK1-mediated NF-kappaB activation-are stimulated by IL-17A to regulate gene induction in human airway epithelial cells.
17965778 Data suggest that IL-17-dependent cellular immunity to collagen type V predisposes to obliterative bronchiolitis in human lung transplants.
17912466 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17912466 These results provide the first evidence that the IL-17F and MIF gene polymorphisms are significantly associated with the development of functional dyspepsia.
17876645 Observational study of gene-disease association. (HuGE Navigator)
17828618 Our results provided the first evidence that -197A (IL-17A) and 7488T (IL-17F) alleles may influence the susceptibility to and pathophysiological features of ulcerative colitis independently.
17828618 Observational study of gene-disease association. (HuGE Navigator)
17703412 Observational study of gene-disease association. (HuGE Navigator)
17682667 IL-17A activity is an important element of pulmonary host defence, but the prolonged action of this cytokine directed on the proliferation, maturing and chemotaxis of neutrophils to the pulmonary tract may contribute to chronic tissue destruction.
17644317 S100A8 is regulated by IL-17, dexamethasone, IL-4 and IL-13 in HaCat cells (human keratinocyte cell line)
17635957 analysis of functional features of human Th17 cells
17613395 IL-17 is associated with the early post-lung transplantation time period and airway CD8+ cells.
17545490 IL-17A can modify epithelial responses to rhinovirus in a manner that would be expected to favor the recruitment of neutrophils, immature dendritic cells, and memory T cells to the airways
17486092 human T helper cells-17 cells have distinct migratory capacity and antigenic specificities
17384030 plays a role as a key regulatory cytokine [in periodontitis]
17083726 The data suggest that Th17 cell infiltration in asthmatic airways links T cell activity with neutrophilic inflammation in asthma.
16874957 IL-17 may have an important role in the occurrence of nasal polyps by specific combination with IL-17R and over-expression in nasal polyps.
16859642 Inhibitors of MEK abrogated the mitogenic effect of IL-17A, whereas an inhibitor of p38 or JNK displayed no significant inhibitory effect.IL-17A stimulates the growth of airway epithelial cells through the ERK MAP kinase pathway.
16533341 In this JEG-3 cell model of human trophoblast, IL-17 may have a regulatory role in trophoblast invasion.
16419159 Data suggest that IL-17 may play an important role in the inflammatory response to Helicobacter pylori colonization of gastric mucosa.
16207434 The IL-17/IL-8 pathway may be involved in the initial neutrophil influx into the airways in severe asthma.
16008887 IL-17 level is associated with the pathogenesis of early endometriosis and endometriosis-associated infertility.
15972674 cell membrane IL-17R is required for signaling by both IL-17A and IL-17F
15916703 The fact that the increased IL-17A mRNA is associated with an increased number of MMP-9-expressing neutrophils is compatible with IL-17A increasing the local proteolytic burden through its neutrophil-accumulating effect.
15845864 IL-17 particularly affects post-transcriptional regulation of IL-8 and IL-6 expression leading to enhanced IL-8 and IL-6 responses to secondary stimuli, and is only a weak proinflammatory stimulus by itself
15811056 total amount in gingival crevicular fluid samples and in the culture supernatants of gingival cells is significantly increased in periodontal disease
15811054 has a potential role in the aetiopathogenesis of periodontal disease
15642151 Review. IL-17 is significant when T cells are a major element of the arthritis process. IL-17 can induce joint destruction in an IL-1-independent manner & can bypass TNF-dependent arthritis.
15535837 Review. IL-17 has proinflammatory properties, particularly the induction of other inflammatory effectors. It synergizes with other cytokines, placing it in the center of the inflammatory network. It is implicated in bone diseases & rheumatoid arthritis.
15459204 NFAT is the crucial sensor of TCR signaling in the IL-17 promoter.
15388258 IL-17 and IL-17F play a differential regulatory role in GM-CSF production by LMVECs stimulated with IL-1beta and/or TNF-alpha, which is sensitive to Th1 and Th2 cytokine modulation
15321994 In Helicobacter pylori-colonized gastric epithelial cells, IL-17-induced IL-8 synthesis is associated with and depends at least in part on the activation of ERK 1/2 MAP kinase.
15305382 upregulation of interleukin 17 is associated with cutaneous T-cell lymphomas
15218177 transcriptional activation of the IL17 gene by Tax protein of HTLV-1 virus.
15025215 could have a significant role in the progression of gingivitis to periodontitis
12772186 IL-17 may play important role in homeostasis via IL-6 upregulation and in regulating inflammation of prostate
12667656 Low levels of IL-17 in combination with IL-1 beta can act on myoblasts and muscle tissue leading to the expression or production of factors involved in muscle inflammation.
12421973 IL-17 plays an important role in the induction and perpetuation of the immunopathologic processes in herpetic stromal keratitis by modulating the secretion of proinflammatory and neutrophil chemotactic factors by corneal resident fibroblasts.
12297109 IL-17 induces a signaling cascade involving src-MAPK activation in human cells
12183057 activation of the ERK pathway is involved in the induction of IL-6 mRNA stabilization by IL-17 plus TNF-alpha.
12165487 IL-17 selectively down-regulates TNF-alpha-induced RANTES gene expression in human colonic subepithelial myofibroblasts.

AA Sequence

MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRS      1 - 70
TSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILV     71 - 140
SVGCTCVTPIVHHVA                                                           141 - 155
//

Text Mined References (891)

PMID Year Title
27049090 Relationship between serum interleukin-17 level and inflammatory bowel disease.
26910014 2016 Association of Interleukin-17 polymorphism (-197G/A) in chronic and localized aggressive periodontitis.
26890073 2016 Genetic Analysis of IL-17 Gene Polymorphisms in Gout in a Male Chinese Han Population.
26875893 2016 Interleukin-17A inhibits cell autophagy under starvation and promotes cell migration via TAB2/TAB3-p38 mitogen-activated protein kinase pathways in hepatocellular carcinoma.
26867135 2016 IL-17a and IL-22 Induce Expression of Antimicrobials in Gastrointestinal Epithelial Cells and May Contribute to Epithelial Cell Defense against Helicobacter pylori.
26850593 2016 Essential role of mitogen-activated protein kinases in IL-17A-induced MMP-3 expression in human synovial sarcoma cells.
26840977 2016 Single Nucleotide Polymorphisms in IL17A and IL6 Are Associated with Decreased Risk for Pulmonary Tuberculosis in Southern Brazilian Population.
26805737 2016 [Role of Interleukin 17 in Lung Carcinogenesis and Lung Cancer Progression].
26783383 2015 Interleukin-17 Could Promote Breast Cancer Progression at Several Stages of the Disease.
26780388 2016 Proinflammatory T cells and IL-17 stimulate osteoblast differentiation.
26771189 2016 Upregulated Cellular Expression of IL-17 by CD4+ T-Cells in Osteoporotic Postmenopausal Women.
26765636 2016 Functional single nucleotide polymorphism in IL-17A 3' untranslated region is targeted by miR-4480 in vitro and may be associated with age-related macular degeneration.
26763436 2016 Molecular Phenotyping Small (Asian) versus Large (Western) Plaque Psoriasis Shows Common Activation of IL-17 Pathway Genes but Different Regulatory Gene Sets.
26744532 2016 Infiltrating Macrophages Induce ER? Expression through an IL17A-mediated Epigenetic Mechanism to Sensitize Endometrial Cancer Cells to Estrogen.
26742440 2015 Interleukin-21 Is Associated with the Pathogenesis of Lumbar Disc Herniation.
26742425 2016 IL-17A up-regulates expression of endothelial tissue factor in liver cirrhosis via the ROS/p38 signal pathway.
26718973 2016 The inhibition of periodontal ligament stem cells osteogenic differentiation by IL-17 is mediated via MAPKs.
26709703 2015 Modulation of Cytokine Secretion Allows CD4 T Cells Secreting IL-10 and IL-17 to Simultaneously Participate in Maintaining Tolerance and Immunity.
26709006 2016 Blockade of Interleukin-17 Restrains the Development of Acute Lung Injury.
26667768 2015 CD45RO+ memory T-cells produce IL-17 in patients with atherosclerosis.
26656739 2015 Integrating longitudinal serum IL-17 and IL-23 follow-up, along with autoantibodies variation, contributes to predict bullous pemphigoid outcome.
26642702 2015 The Serum Value of NO and IL-17 were Increased in Children with Influenza A Viral Pneumonia.
26618234 2016 Elevated plasma interleukin-17A in a subgroup of Myasthenia Gravis patients.
26617905 2015 Association between interleukin-17 gene polymorphisms and risk of coronary artery disease.
26616164 2016 Correlation between nerve growth factor and tissue expression of IL-17 in leprosy.
26602091 2015 Evidence of IL-17, IP-10, and IL-10 involvement in multiple-organ dysfunction and IL-17 pathway in acute renal failure associated to Plasmodium falciparum malaria.
26583099 2015 Th17 Cell Plasticity and Functions in Cancer Immunity.
26558442 2016 Interleukin 17 inhibits progenitor cells in rheumatoid arthritis cartilage.
26535675 2015 Association analysis of rs2275913G>A and rs763780T>C interleukin 17 polymorphisms in Chinese women with cervical cancer.
26535650 2015 Role of IL-17 gene polymorphisms in the susceptibility to gastric cancer.
26521730 2015 Differential expression of interleukin-17 and interleukin-22 in inflamed and non-inflamed synovium from osteoarthritis patients.
26515887 2016 Interleukin-17A rs2275913, Interleukin-17F rs763780 and rs2397084 gene polymorphisms as possible risk factors in Juvenile lupus and lupus related nephritis.
26507122 2016 Human umbilical cord derived mesenchymal stem cells promote interleukin-17 production from human peripheral blood mononuclear cells of healthy donors and systemic lupus erythematosus patients.
26505478 2015 Interleukin-17A and Toll-Like Receptor 3 Ligand Poly(I:C) Synergistically Induced Neutrophil Chemoattractant Production by Bronchial Epithelial Cells.
26505366 2015 Association analysis of IL-17A and IL-17F polymorphisms in Chinese women with cervical cancer.
26504859 2015 The Interplay between Zinc, Vitamin D and, IL-17 in Patients with Chronic Hepatitis C Liver Disease.
26491867 2016 Different Blood-Borne Human Osteoclast Precursors Respond in Distinct Ways to IL-17A.
26489621 2015 IL-17 Induces MPTP opening through ERK2 and P53 signaling pathway in human platelets.
26481531 2015 Decrease of interleukin (IL)17A gene expression in leucocytes and in the amount of IL-17A protein in CD4+ T cells in children with Down Syndrome.
26468780 2015 Investigation of the role of IL17A gene variants in Chagas disease.
26467330 2015 Interleukin-17 and leptin genes polymorphisms and their levels in relation to recurrent pregnancy loss in Egyptian females.
26464720 2015 Association between interluekin-17 gene polymorphisms and the risk of cervical cancer in a Chinese population.
26461825 2015 Psoriasis Targeted Therapy: Characterization of Interleukin 17A Expression in Subtypes of Psoriasis.
26456334 2015 IL-17A Is Increased in Humans with Primary Hyperparathyroidism and Mediates PTH-Induced Bone Loss in Mice.
26453305 2015 TRAF5-mediated Lys-63-linked Polyubiquitination Plays an Essential Role in Positive Regulation of ROR?t in Promoting IL-17A Expression.
26451724 2015 Role of IL-17 Variants in Preeclampsia in Chinese Han Women.
26447633 2015 Influence of the IL17A and IL17F gene polymorphisms on the long-term kidney allograft function and return to dialysis after kidney transplantation.
26445528 2015 The IL-17A G-197A and IL-17F 7488T/C polymorphisms are associated with increased risk of cancer in Asians: a meta-analysis.
26440138 2016 Emerging roles of the Th17/IL-17-axis in glomerulonephritis.
26436389 2015 Correlation between polymorphisms in the IL-17A and IL-17F genes and development of coronary artery disease.
26400286 2015 Elucidating the function and tolerance mechanism of gamma delta (? ?) T cells in a Helicobacter pylori infection model.
26391982 2015 HMGB1/RAGE induces IL-17 expression to exaggerate inflammation in peripheral blood cells of hepatitis B patients.
26376306 2015 The Gene Polymorphism of IL-17 G-152A is Associated with Increased Colonization of Streptococcus pneumoniae in Young Finnish Children.
26374165 2015 Antagonistic effects of IL-17 and D-resolvins on endothelial Del-1 expression through a GSK-3?-C/EBP? pathway.
26367076 2015 IL17A gene polymorphism, serum IL17 and total IgE in Egyptian population with chronic HCV and hepatocellular carcinoma.
26356122 2015 Expression of IL-17A, E, and F and their receptors in human prostatic cancer: Comparison with benign prostatic hyperplasia.
26345782 2015 Influence of interleukin-17 gene polymorphisms on the development of pulmonary tuberculosis.
26339129 2015 The Influence of Interleukin 17A and IL17F Polymorphisms on Chronic Periodontitis Disease in Brazilian Patients.
26337284 2016 Association study between IL-17A and IL-17F gene polymorphism and myasthenia gravis in Chinese patients.
26302175 2015 Relationship between female genital tract infections, mucosal interleukin-17 production and local T helper type 17 cells.
26301881 2015 Interleukin-17 levels correlate with poor prognosis and vascular endothelial growth factor concentration in the serum of patients with non-small cell lung cancer.
26300019 2015 IL-17 polymorphisms and asthma risk: a meta-analysis of 11 single nucleotide polymorphisms.
26296754 2015 Angiotensin converting enzyme activity is positively associated with IL-17a levels in patients with schizophrenia.
26295034 2015 CCL27: Novel Cytokine with Potential Role in Pathogenesis of Multiple Sclerosis.
26279438 2015 Interleukin-17 Stimulates STAT3-Mediated Endothelial Cell Activation for Neutrophil Recruitment.
26263971 2015 Interleukin-17A Gene Expression in Morbidly Obese Women.
26261639 2015 Interleukin-17A gene polymorphism is associated with susceptibility to gastric cancer.
26259585 2015 IL-17A Contributes to the Pathogenesis of Endometriosis by Triggering Proinflammatory Cytokines and Angiogenic Growth Factors.
26242299 2015 Estrogen and progesterone decrease let-7f microRNA expression and increase IL-23/IL-23 receptor signaling and IL-17A production in patients with severe asthma.
26232149 2015 Increased circulating interleukin-17 levels in preeclampsia.
26223249 2015 Polymorphisms in interleukin 17A gene and coal workers' pneumoconiosis risk in a Chinese population.
26208902 2015 IL17 Promotes Mammary Tumor Progression by Changing the Behavior of Tumor Cells and Eliciting Tumorigenic Neutrophils Recruitment.
26205065 2016 Assessment of angiogenesis modulators in pregnant women with pre-eclampsia: a case-control study.
26198928 2015 Effect of high dose vitamin D intake on interleukin-17 levels in multiple sclerosis: a randomized, double-blind, placebo-controlled clinical trial.
26198032 2015 Cigarette smoke affects IL-17A, IL-17F and IL-17 receptor expression in the lung tissue: Ex vivo and in vitro studies.
26191290 2015 Correlation between acute myeloid leukemia and IL-17A, IL-17F, and IL-23R gene polymorphism.
26191227 2015 Changes in levels of IL-9, IL-17, IFN-?, dendritic cell numbers and TLR expression in peripheral blood in asthmatic children with Mycoplasma pneumoniae infection.
26174551 2015 IL-17/IL-10 double-producing T cells: new link between infections, immunosuppression and acute myeloid leukemia.
26165685 2015 Prognostic value of serum IL-17 and VEGF levels in small cell lung cancer.
26164762 2015 A meta-analysis: The association between interleukin-17 pathway gene polymorphism and gastrointestinal diseases.
26154773 2015 The Influence of Polymorphisms of Interleukin-17A and -17F Genes on Susceptibility and Activity of Rheumatoid Arthritis.
26151690 2015 New insight to IL-23/IL-17 axis in Iranian infected adult patients with gastritis: effects of genes polymorphisms on expression of cytokines.
26125910 2015 IL-17A and IL-17F polymorphisms and gastric cancer risk: a meta-analysis.
26119194 2015 Investigating the Association of IL-17A and IL-17F with Susceptibility to Pre-eclampsia in Iranian Women.
26115945 2015 Multiple sclerosis and susceptibility to cardiovascular diseases: Implications of ethnicity-related interleukin-17A gene polymorphism?
26083022 2015 Involvement of IL17A, IL17F and IL23R Polymorphisms in Colorectal Cancer Therapy.
26079624 2015 Increased expression of TLR2 in CD4(+) T cells from SLE patients enhances immune reactivity and promotes IL-17 expression through histone modifications.
26077826 2015 The paradoxical role of IL-17 in atherosclerosis.
26073684 2015 The role of serum IL-17 and IL-6 as biomarkers of disease activity and predictors of remission in patients with lupus nephritis.
26072972 2015 TL1A as a Potential Local Inducer of IL17A Expression in Colon Mucosa of Inflammatory Bowel Disease Patients.
26043025 2015 Simvastatin Suppresses Airway IL-17 and Upregulates IL-10 in Patients With Stable COPD.
26018190 2015 Impaired M. tuberculosis Antigen-Specific IFN-? Response without IL-17 Enhancement in Patients with Severe Cavitary Pulmonary Tuberculosis.
26017027 2015 Investigation of interleukin-12, interleukin-17 and interleukin-23 receptor gene polymorphisms in alopecia areata.
26002979 2015 Unexpected Role for Adaptive ??Th17 Cells in Acute Respiratory Distress Syndrome.
25987798 2015 Association of IL-17 polymorphisms with gastric cancer risk in Asian populations.
25975002 2015 Role of rhIL-17 in regulating the mitochondrial pathway proteins in peripheral blood neutrophils.
25966103 2015 Changes to the migratory inhibitory factor, IL-17, and IL-10 levels in serum from chronic hepatitis B patients and clinical significance following Baraclude(®) treatment.
25934649 2015 Long-term sublingual immunotherapy for Japanese cedar pollinosis and the levels of IL-17A and complement components 3a and 5a.
25933188 2015 IL17 Mediates Pelvic Pain in Experimental Autoimmune Prostatitis (EAP).
25922848 2015 Low baseline interleukin-17A levels are associated with better treatment response at 12 weeks to tocilizumab therapy in rheumatoid arthritis patients.
25887118 2015 IL-17 and IL-23 in lupus nephritis - association to histopathology and response to treatment.
25871515 2015 Association between interleukin 17A polymorphisms and susceptibility to rheumatoid arthritis in a Chinese population.
25869448 2015 Clinical relevance of the number of interleukin-17-producing CD 8+ T cells in patients with gastric cancer.
25857634 2015 Genetic Polymorphisms in the Toll-like Receptor 10, Interleukin (IL)17A and IL17F Genes Differently Affect the Risk for Tuberculosis in Croatian Population.
25849622 2015 Regulation of IL-17A responses in human airway smooth muscle cells by Oncostatin M.
25845273 2016 The role of interleukin-17 in intrahepatic cholestasis of pregnancy.
25844618 2015 IL-17A Is Elevated in End-Stage Chronic Obstructive Pulmonary Disease and Contributes to Cigarette Smoke-induced Lymphoid Neogenesis.
25842551 2015 Immune mechanisms in type-2 diabetic retinopathy.
25834404 2015 Human colon carcinogenesis is associated with increased interleukin-17-driven inflammatory responses.
25833686 2015 Human monocyte-derived dendritic cells turn into foamy dendritic cells with IL-17A.
25794823 2015 IL-17 and neutrophils: unexpected players in the type 2 immune response.
25793426 2015 IL-17, IL-23, and p73 expression in cutaneous melanoma: a pilot study.
25776751 2015 Activated human valvular interstitial cells sustain interleukin-17 production to recruit neutrophils in infective endocarditis.
25771887 2015 The possible role of CD4?CD25(high)Foxp3?/CD4?IL-17A? cell imbalance in the autoimmunity of patients with Hashimoto thyroiditis.
25740946 2015 Demethylation of the RORC2 and IL17A in human CD4+ T lymphocytes defines Th17 origin of nonclassic Th1 cells.
25706309 2015 Human papillomavirus infection correlates with inflammatory Stat3 signaling activity and IL-17 level in patients with colorectal cancer.
25703059 2015 Plasma IL-33 in atopic patients correlates with pro-inflammatory cytokines and changes cholesterol transport protein expression: a surprising neutral overall impact on atherogenicity.
25693940 2014 Plasma interleukin 17 in the diagnosis of hepatocellular carcinoma: a retrospective study of 39 cases.
25682556 2015 Interleukin-17-producing CD4(+) cells home to the graft early after human heart transplantation.
25680555 2015 Interleukin-17FT7488 allele is associated with a decreased risk of colorectal cancer and tumor progression.
25649806 2015 Interleukin 23 levels are increased in carotid atherosclerosis: possible role for the interleukin 23/interleukin 17 axis.
25625963 2015 The role of Th17 cells in patients with relapsing-remitting multiple sclerosis: interleukin-17A and interleukin-17F serum levels.
25615631 2015 Interleukin-17A gene haplotypes are associated with risk of premature coronary artery disease in Mexican patients from the Genetics of Atherosclerotic Disease (GEA) study.
25614889 2014 Serum levels of TNF- ? , IL-12/23 p40, and IL-17 in psoriatic patients with and without nail psoriasis: a cross-sectional study.
25596084 2015 Association between six genetic variants of IL-17A and IL-17F and cervical cancer risk: a case-control study.
25595174 2015 Specific association of IL17A genetic variants with panuveitis.
25579009 2015 Interleukin 17A and interleukin 17F polymorphisms are associated with oral squamous cell carcinoma susceptibility in a Chinese population.
25562560 Serum interleukin 17, interleukin 23, and interleukin 10 values in children with atopic eczema/dermatitis syndrome (AEDS): association with clinical severity and phenotype.
25553723 2014 Clinical features and expressions of Foxp3 and IL-17 in type 1 autoimmune pancreatitis in China.
25549592 2014 Increased IL-17A in atrial fibrillation correlates with neutrophil to lymphocyte ratio.
25544504 2015 IL-17 induces radiation resistance of B lymphoma cells by suppressing p53 expression and thereby inhibiting irradiation-triggered apoptosis.
25542095 2015 Serum IL-9, IL-17, and TGF-? levels in subjects with diabetic kidney disease (CURES-134).
25536226 Serum interleukin-17 in primary Sjögren's syndrome: association with disease duration and parotid gland swelling.
25525302 2014 Clinical significance of IL-23 regulating IL-17A and/or IL-17F positive Th17 cells in chronic periodontitis.
25514475 Increased IL-22 level in allergic rhinitis significantly correlates with clinical severity.
25510225 2014 Polymorphism of interleukin-17 and its relation to mineral density of bones in perimenopausal women.
25500254 2015 Association of IL-17A and IL-17F polymorphisms with gastric cancer risk in Asians: a meta-analysis.
25499021 2015 Exopolysaccharides from Cyanobacterium aponinum from the Blue Lagoon in Iceland increase IL-10 secretion by human dendritic cells and their ability to reduce the IL-17+ROR?t+/IL-10+FoxP3+ ratio in CD4+ T cells.
25484349 2015 Association between interleukin 17/interleukin 17 receptor gene polymorphisms and papillary thyroid cancer in Korean population.
25484038 2014 Mining the human autoantibody repertoire: isolation of potent IL17A-neutralizing monoclonal antibodies from a patient with thymoma.
25469655 2015 Interleukin 17A genetic variations and susceptibility to non-small cell lung cancer.
25445614 2014 A lack of confirmation with alternative assays questions the validity of IL-17A expression in human neutrophils using immunohistochemistry.
25433194 2015 Urokinase type plasminogen activator mediates Interleukin-17-induced peripheral blood mesenchymal stem cell motility and transendothelial migration.
25429834 2015 Interleukin-17A and interleukin-17F gene polymorphisms and hepatitis B virus-related hepatocellular carcinoma risk in a Chinese population.
25427574 2014 Upregulation of IL-17A/F from human lung tissue explants with cigarette smoke exposure: implications for COPD.
25422215 2014 Association between the interleukin-17A -197G>A (rs2275913) polymorphism and risk of digestive cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25413124 2015 Increased miR-155 expression in peripheral blood mononuclear cells of primary immune thrombocytopenia patients was correlated with serum cytokine profiles.
25387578 2015 IL-17A, IL-17F and IL-23R Gene Polymorphisms in Polish Patients with Rheumatoid Arthritis.
25374195 2014 Meta-analysis of associations between interleukin-17 gene polymorphisms and risk of gastric cancer.
25340344 2014 A critical role for IL-17RB signaling in HTLV-1 tax-induced NF-?B activation and T-cell transformation.
25329073 2014 Treg/IL-17 ratio and Treg differentiation in patients with COPD.
25323532 2015 Function of interleukin-17 and -35 in the blood of patients with hepatitis B-related liver cirrhosis.
25308308 2015 Enhanced expression of indoleamine 2,3-dioxygenase in Helicobacter pylori-infected human gastric mucosa modulates Th1/Th2 pathway and interleukin 17 production.
25308296 2014 DAMP molecules S100A9 and S100A8 activated by IL-17A and house-dust mites are increased in atopic dermatitis.
25289477 2015 Interleukin 17A polymorphism elevates gene expression and is associated with increased risk of nonsmall cell lung cancer.
25288779 2015 IL-17-producing CD4+ T cells are increased in early, active axial spondyloarthritis including patients without imaging abnormalities.
25288569 2014 Two novel gain-of-function mutations of STAT1 responsible for chronic mucocutaneous candidiasis disease: impaired production of IL-17A and IL-22, and the presence of anti-IL-17F autoantibody.
25274569 2015 Interleukin 17A acts synergistically with interferon ? to promote protection against Leishmania infantum infection.
25273526 2014 The relationship between asymptomatic organ damage, and serum soluble tumor necrosis factor-like weak inducer of apoptosis (sTWEAK) and Interleukin-17A (IL-17A) levels in non-diabetic hypertensive patients.
25257435 2014 Association of G197 polymorphism of IL-17A gene with myocardial remodeling and aerobic performance in athletes.
25256120 2014 Egr-1 is a key regulator of IL-17A-induced psoriasin upregulation in psoriasis.
25250801 2014 IL-17A promotes the migration and invasiveness of cervical cancer cells by coordinately activating MMPs expression via the p38/NF-?B signal pathway.
25241192 2014 CD4 aptamer-ROR?t shRNA chimera inhibits IL-17 synthesis by human CD4(+) T cells.
25227691 2014 Association of IL-17A and IL-17 F gene polymorphisms with recurrent pregnancy loss in Iranian women.
25223230 2015 The A/A genotype of an interleukin-17A polymorphism predisposes to increased severity of atopic dermatitis and coexistence with asthma.
25216863 2014 Association between Toll-like receptor 4 and interleukin 17 gene polymorphisms and colorectal cancer susceptibility in Northeast China.
25210118 2014 IL-17A enhances the expression of profibrotic genes through upregulation of the TGF-? receptor on hepatic stellate cells in a JNK-dependent manner.
25197971 2014 Intratumor IL-17-positive mast cells are the major source of the IL-17 that is predictive of survival in gastric cancer patients.
25162311 2014 IL-17 in severe asthma. Where do we stand?
25149761 2015 Elevated levels of interleukin 17A and kynurenine in candidemic patients, compared with levels in noncandidemic patients in the intensive care unit and those in healthy controls.
25138977 2014 IL-17 and IL-22 serum levels in greenhouse workers exposed to pesticides.
25136988 2014 High IL-17E and low IL-17C dermal expression identifies a fibrosis-specific motif common to morphea and systemic sclerosis.
25136146 2014 IL-17 genetic and immunophenotypic evaluation in chronic graft-versus-host disease.
25129403 2014 Elevated levels of Th17 cells and Th17-related cytokines are associated with disease activity in patients with inflammatory bowel disease.
25128193 2014 Vitamin D deficiency and lower TGF-?/IL-17 ratio in a North Indian cohort of pemphigus vulgaris.
25100151 2014 Circulating levels of miR-146a and IL-17 are significantly correlated with the clinical activity of Graves' ophthalmopathy.
25092442 2014 Is serum Interleukin-17 associated with early atherosclerosis in obese patients?
25088788 2014 Should IFN-?, IL-17 and IL-2 be considered predictive biomarkers of acute rejection in liver and kidney transplant? Results of a multicentric study.
25080350 2014 Increased interleukin-17 in peripheral blood and cerebrospinal fluid of neurosyphilis patients.
25058615 2015 IL-17A production in human psoriatic blood and lesions by CD146+ T cells.
25054133 2014 Poststroke neuropsychiatric symptoms: relationships with IL-17 and oxidative stress.
25046339 2014 IL-19 is a component of the pathogenetic IL-23/IL-17 cascade in psoriasis.
25039885 2014 Cellular sources of IL-17 in psoriasis: a paradigm shift?
25038189 2014 Promotion of lung tumor growth by interleukin-17.
25030504 2014 Innate immune cells express IL-17A/F in acute generalized exanthematous pustulosis and generalized pustular psoriasis.
25028103 2015 Genetic variants of interleukin 17A are functionally associated with increased risk of age-related macular degeneration.
25015721 2015 Interleukin-17 is a favorable prognostic marker for colorectal cancer.
25012243 2014 IL-17 gene polymorphism is associated with susceptibility to gastric cancer.
25008567 2014 IL-17A G197A and C1249T polymorphisms in gastric carcinogenesis.
24999591 2014 IL-17 induces inflammation-associated gene products in blood monocytes, and treatment with ixekizumab reduces their expression in psoriasis patient blood.
24995325 2014 Serum IL-17, IL-23, and TGF-? levels in type 1 and type 2 diabetic patients and age-matched healthy controls.
24993165 2014 The cytokine production of peripheral blood mononuclear cells reflects the autoantibody profile of patients suffering from type 1 diabetes.
24990235 2014 Surface expression of CD39 identifies an enriched Treg-cell subset in the rheumatic joint, which does not suppress IL-17A secretion.
24975574 2014 Human interleukin-27: wide individual variation in plasma levels and complex inter-relationships with interleukin-17A.
24968286 2014 Association of IL-17 gene polymorphisms and serum level with graft versus host disease after allogeneic hematopoietic stem cell transplantation.
24965422 IL-17A G197A and IL-17F T7488C polymorphisms and cancer risk in Asian populations: a meta-analysis.
24962673 2014 Higher levels of interleukin IL-17 and antigen-specific IL-17 responses in pulmonary sarcoidosis patients with Löfgren's syndrome.
24958901 2014 Differentiation of IL-17-producing effector and regulatory human T cells from lineage-committed naive precursors.
24954262 2014 TNF-?/IL-17 synergy inhibits IL-13 bioactivity via IL-13R?2 induction.
24945093 2014 Innate immune cell-produced IL-17 sustains inflammation in bullous pemphigoid.
24927491 2014 IL-17A concentration of seminal plasma and follicular fluid in infertile men and women with various clinical diagnoses.
24925921 2014 Interleukin-17 cytokine signalling in patients with asthma.
24919524 2014 Endogenous interleukin-6 amplifies interleukin-17 production and corticoid-resistance in peripheral T cells from patients with multiple sclerosis.
24919468 2014 Influence of the IL17A locus in giant cell arteritis susceptibility.
24916639 2014 Interleukin-17 receptor expression on vascular endothelial cells of masses of skeletal extramedullary disease in myeloma patients.
24899787 2014 Circulating Th17, Th22, and Th1 cells are elevated in the Guillain-Barré syndrome and downregulated by IVIg treatments.
24899786 2014 Overexpression of interleukin-23 and interleukin-17 in the lesion of pemphigus vulgaris: a preliminary study.
24893702 2014 Interleukin 17A rs3819024 A>G polymorphism is associated with an increased risk of gastric cardia adenocarcinoma in a Chinese population.
24887477 2014 Elevated pleural effusion IL-17 is a diagnostic marker and outcome predictor in lung cancer patients.
24861949 2014 Inflammatory cytokines and VEGF measured in exhaled breath condensate are correlated with tumor mass in non-small cell lung cancer.
24859972 2015 Elevated proinflammatory cytokine IL-17A in the adjacent tissues along the adenoma-carcinoma sequence.
24857622 2014 IL-17F but not IL-17A gene polymorphism confers risk to multiple sclerosis in a Chinese Han population.
24813240 2014 Interleukin-17 facilitates the immune suppressor capacity of high-grade glioma-derived CD4 (+) CD25 (+) Foxp3 (+) T cells via releasing transforming growth factor beta.
24813051 2014 Interleukin (IL)-17A, F and AF in inflammation: a study in collagen-induced arthritis and rheumatoid arthritis.
24788601 2014 Potential role of IL-17-producing iNKT cells in type 1 diabetes.
24787050 2014 An innovative three-dimensional model of normal human skin to study the proinflammatory psoriatic effects of tumor necrosis factor-alpha and interleukin-17.
24762139 2015 What is the impact of SOCS3, IL-35 and IL17 in immune pathogenesis of recurrent pregnancy loss?
24743018 2014 Detection of IL-17A-producing peripheral blood monocytes in Langerhans cell histiocytosis patients.
24731052 2014 Serum interleukin-17 as a diagnostic and prognostic marker for non-small cell lung cancer.
24699997 2014 Significant association between interleukin-17A polymorphism and colorectal cancer.
24677375 2014 Interleukin-17A modulates circulating tumor cells in tumor draining vein of colorectal cancers and affects metastases.
24670684 2014 Defective neutrophil recruitment in leukocyte adhesion deficiency type I disease causes local IL-17-driven inflammatory bone loss.
24664698 2014 Molecular pathology of macrophages and interleukin-17 in age-related macular degeneration.
24655820 2014 Interleukin 17A: toward a new understanding of psoriasis pathogenesis.
24643836 2014 Phosphorylated STAT3 and PD-1 regulate IL-17 production and IL-23 receptor expression in Mycobacterium tuberculosis infection.
24642072 2014 Participation of interleukin 17A in neuroimmune interactions.
24633013 2014 Decidual stromal cells recruit Th17 cells into decidua to promote proliferation and invasion of human trophoblast cells by secreting IL-17.
24632587 2014 Negative association of serum IL-6 and IL-17 with type-II diabetes retinopathy.
24632586 2014 Interleukin-17 gene expression and serum levels in acute rejected and non-rejected liver transplant patients.
24610014 2014 Epidermal Th22 and Tc17 cells form a localized disease memory in clinically healed psoriasis.
24579469 2013 [The effects of recombinant human beta-defensin-3 on expression of interleukin-17A and interleukin-22 in BEAS-2B cell].
24570184 2014 Increased expression of IL17A in human gastric cancer and its potential roles in gastric carcinogenesis.
24557630 2015 A significant induction of neutrophilic chemoattractants but not RANKL in synoviocytes stimulated with interleukin 17.
24552849 2014 IL-17A is a novel player in dialysis-induced peritoneal damage.
24548421 2014 Interleukin-17A and -17F genes polymorphisms in lung cancer.
24534724 2014 Involvement of interleukin-17A-induced expression of heat shock protein 47 in intestinal fibrosis in Crohn's disease.
24532300 2014 IL-17A in hepatitis B infection: friend or foe?
24508995 2014 Interleukin-17A in lipid metabolism and atherosclerosis.
24482023 2014 Studying IFN-gamma, IL-17 and FOXP3 in pediatric lupus nephritis.
24447082 2014 Differential expression of 11?-hydroxysteroid dehydrogenase type 1 and 2 in mild and moderate/severe persistent allergic nasal mucosa and regulation of their expression by Th2 cytokines: asthma and rhinitis.
24434314 2013 Modulation of autoimmune diseases by interleukin (IL)-17 producing regulatory T helper (Th17) cells.
24420723 2014 Clinical parameter and Th17 related to lymphocytes infiltrating degree of labial salivary gland in primary Sjögren's syndrome.
24412596 CD28 ligation in the absence of TCR stimulation up-regulates IL-17A and pro-inflammatory cytokines in relapsing-remitting multiple sclerosis T lymphocytes.
24409674 2013 The changes in the levels of IL-6, IL-17, and IL-21 in the acute stage of childhood asthma.
24409666 2013 Inverse relationship of serum IL-17 with type-II diabetes retinopathy.
24405842 2014 Both Treg cells and Tconv cells are defective in the Myasthenia gravis thymus: roles of IL-17 and TNF-?.
24394601 2014 Sampling of proximal and distal duodenal biopsies in the diagnosis and monitoring of celiac disease.
24393079 2014 IL-17A and IL-17F genes variants and susceptibility to childhood asthma in Tunisia.
24393021 2014 IL-17A mediates a selective gene expression profile in asthmatic human airway smooth muscle cells.
24383677 2014 IL-17 and glutamate excitotoxicity in the pathogenesis of multiple sclerosis.
24379648 2013 Interleukin-17 production and T helper 17 cells in peripheral blood mononuclear cells in response to ocular lysate in patients with birdshot chorioretinopathy.
24376862 2013 IL-17A induces endothelial inflammation in systemic sclerosis via the ERK signaling pathway.
24363402 2014 IL-17 protects T cells from apoptosis and contributes to development of ALPS-like phenotypes.
24355795 2014 Inflammatory cytokines in Paget's disease of bone.
24352375 2014 IL-17A increases the expression of proinflammatory chemokines in human pancreatic islets.
24345576 2014 The role of interchain disulfide bond in a recombinant human interleukin-17A variant.
24340045 2013 B cells contribute to heterogeneity of IL-17 producing cells in rheumatoid arthritis and healthy controls.
24337660 2014 IL-17A-mediated sRANK ligand elevation involved in postmenopausal osteoporosis.
24323355 2013 Chemotherapy activates cancer-associated fibroblasts to maintain colorectal cancer-initiating cells by IL-17A.
24319050 2014 Association between severity of knee osteoarthritis and serum and synovial fluid interleukin 17 concentrations.
24317395 2014 In vivo induction of cutaneous inflammation results in the accumulation of extracellular trap-forming neutrophils expressing ROR?t and IL-17.
24316750 2013 IL-17A is produced by breast cancer TILs and promotes chemoresistance and proliferation through ERK1/2.
24315816 2014 Effect of interleukin-17A and interleukin-17F gene polymorphisms on the risk of gastric cancer in a Chinese population.
24303990 2014 Intrahepatic interleukin-17+ T cells and FoxP3+ regulatory T cells cooperate to promote development and affect the prognosis of hepatocellular carcinoma.
24292092 2014 Expression of Foxp3 and interleukin-17 in lichen planus lesions with emphasis on difference in oral and cutaneous variants.
24286492 2013 Th17 and Th22 cells in psoriatic arthritis and psoriasis.
24247026 2013 The role of Th17/IL-17 in the pathogenesis of primary nephrotic syndrome in children.
24236690 2014 Ratios of regulatory T cells/T-helper 17 cells and transforming growth factor-?1/interleukin-17 to be associated with the development of hepatitis B virus-associated liver cirrhosis.
24223764 2013 Th17/IL-17A might play a protective role in chronic lymphocytic leukemia immunity.
24219883 2013 Increased interleukin-17 in the cerebrospinal fluid in sporadic Creutzfeldt-Jakob disease: a case-control study of rapidly progressive dementia.
24218334 2014 Analysis of the association of interleukin-17 gene polymorphisms with gastric cancer risk and interaction with Helicobacter pylori infection in a Chinese population.
24211680 2014 Combined analysis of cytokine gene polymorphism and the level of expression with allograft function in kidney transplant recipients.
24194936 2013 Local IL-17A potentiates early neutrophil recruitment to the respiratory tract during severe RSV infection.
24185279 Verification of IL-17A and IL-17F in oral tissues and modulation of their expression pattern by steroid hormones.
24177608 Estimation of serum level of interleukin-17 and interleukin-4 in leprosy, towards more understanding of leprosy immunopathogenesis.
24175805 2013 Elevated serum IL-17A but not IL-6 in glioma versus meningioma and schwannoma.
24164540 2014 CD49a promotes T-cell-mediated hepatitis by driving T helper 1 cytokine and interleukin-17 production.
24141678 Interleukin-17A expression in patients presenting with nasal polyposis.
24129673 2014 Coexistent skin lesions of vitiligo and psoriasis vulgaris. Immunohistochemical analyses for IL-17A-producing cells and regulatory T cells.
24128872 2013 Reference range and short- and long-term biological variation of interleukin (IL)-6, IL-17A and tissue necrosis factor-alpha using high sensitivity assays.
24120361 2013 An ACT1 mutation selectively abolishes interleukin-17 responses in humans with chronic mucocutaneous candidiasis.
24112799 2014 Increased expression of IL-17A and limited involvement of IL-23 in patients with palmo-plantar (PP) pustular psoriasis or PP pustulosis; results from a randomised controlled trial.
24096234 2014 Association of IL-17A and IL-17F single nucleotide polymorphisms with susceptibility to osteoarthritis in a Korean population.
24086143 2013 IL-17 attenuates degradation of ARE-mRNAs by changing the cooperation between AU-binding proteins and microRNA16.
24080022 2013 Increased prevalence of autoimmune phenomena in myelofibrosis: relationship with clinical and morphological characteristics, and with immunoregulatory cytokine patterns.
24076595 2013 Interleukin-17 gene expression and serum levels in children with severe asthma.
24072496 2014 Diagnostic value of pleural interleukin 17 and carcinoembryonic antigen in lung cancer patients with malignant pleural effusions.
24042116 2013 Interleukin-10 (IL-10) inhibits Borrelia burgdorferi-induced IL-17 production and attenuates IL-17-mediated Lyme arthritis.
24040001 2013 Differential expression of IL-17, 22 and 23 in the progression of colorectal cancer in patients with K-ras mutation: Ras signal inhibition and crosstalk with GM-CSF and IFN-?.
24039363 2013 Polymorphism in the interleukin-17A promoter contributes to gastric cancer.
24032570 2013 Multiplex analyses of cytokine and chemokine release from the cultured fibroblast of nasal polyps: the effect of IL-17A.
24021410 Increased levels of IL-17A in patients with fibromyalgia.
23995070 2013 Act1 mediates IL-17-induced EAE pathogenesis selectively in NG2+ glial cells.
23994890 2013 IL-17A promotes immune cell recruitment in human esophageal cancers and the infiltrating dendritic cells represent a positive prognostic marker for patient survival.
23970818 2013 IL-17 expression in dermatitis herpetiformis and bullous pemphigoid.
23968496 2013 Clinical associations of serum interleukin-17 in systemic lupus erythematosus.
23966065 2013 Serum IL-17A in newly diagnosed treatment-naive patients with ulcerative colitis reflects clinical disease severity and predicts the course of disease.
23965869 2013 [Changes in IL-17 and TGF-?1 levels in serum and bronchoalveolar lavage fluid and their clinical significance among children with asthma].
23957337 2013 Increased IL-17A secreting CD4+ T cells, serum IL-17 levels and exhaled nitric oxide are correlated with childhood asthma severity.
23957336 2013 Sputum cytokine mapping reveals an 'IL-5, IL-17A, IL-25-high' pattern associated with poorly controlled asthma.
23924903 2014 Propionibacterium acnes Induces an IL-17 Response in Acne Vulgaris that Is Regulated by Vitamin A and Vitamin D.
23923066 2013 IL4 and IL-17A provide a Th2/Th17-polarized inflammatory milieu in favor of TGF-?1 to induce bronchial epithelial-mesenchymal transition (EMT).
23917206 2013 IL-17 family cytokines mediated signaling in the pathogenesis of inflammatory diseases.
23910013 2013 Increased IL-23 and IL-17 expression by peripheral blood cells of patients with primary biliary cirrhosis.
23895419 2014 Interleukin 17A rs4711998 A>G polymorphism was associated with a decreased risk of esophageal cancer in a Chinese population.
23888551 2012 Association of the CagA gene positive Helicobacter pylori and tissue levels of interleukin-17 and interleukin-8 in gastric ulcer patients.
23876429 2013 Lack of association between IL17A and IL17F polymorphisms and related serum levels in north Indians with tuberculosis.
23857601 2013 IL-17A stimulates the progression of giant cell tumors of bone.
23849453 2013 Expression levels of IL-27 and IL-17 in multiple myeloma patients: a higher ratio of IL-27:IL-17 in bone marrow was associated with a superior progression-free survival.
23842754 2013 IL-17A plays a critical role in the pathogenesis of liver fibrosis through hepatic stellate cell activation.
23826419 2013 Pathologic finding of increased expression of interleukin-17 in the synovial tissue of rheumatoid arthritis patients.
23825942 2013 Hepatitis B virus induces IL-23 production in antigen presenting cells and causes liver damage via the IL-23/IL-17 axis.
23815507 2013 Enhanced and persistent levels of interleukin (IL)-17? CD4? T cells and serum IL-17 in patients with early inflammatory arthritis.
23811547 2013 Interleukin-17 serum levels and TLR4 polymorphisms in ulcerative colitis.
23800789 2013 The IL17A and IL17F loci have divergent histone modifications and are differentially regulated by prostaglandin E2 in Th17 cells.
23800059 2013 TNF?- and IL-17A-mediated S100A8 expression is regulated by p38 MAPK.
23778030 2013 The IL-17 G-152A single nucleotide polymorphism is associated with pulmonary tuberculosis in northern Spain.
23765637 2013 In vitro effects of IL-17 on angiogenic properties of endothelial cells in relation to oxygen levels.
23765061 2014 Staphylococcal enterotoxin B induced expression of IL-17A in nasal epithelial cells and its association with pathogenesis of nasal polyposis.
23764374 2013 Expression of IL-33 in the epidermis: The mechanism of induction by IL-17.
23732752 2013 IL-17 and TNF synergistically modulate cytokine expression while suppressing melanogenesis: potential relevance to psoriasis.
23711712 2013 Correlation of chronic periodontitis in tropical area and IFN-?, IL-10, IL-17 levels.
23695682 2013 Crystal structures of interleukin 17A and its complex with IL-17 receptor A.
23692034 2013 CD4(+) T cells producing interleukin (IL)-17, IL-22 and interferon-? are major effector T cells in nickel allergy.
23690194 2013 Serum levels of IL-17 in patients with vernal keratoconjunctivitis: a preliminary report.
23683514 2013 Enhanced production of IL-17A in patients with severe asthma is inhibited by 1?,25-dihydroxyvitamin D3 in a glucocorticoid-independent fashion.
23664273 2013 Superantigens induce IL-17 production from polarized Th1 clones.
23661335 2013 Correlations between concentrations of interleukin (IL)-17A, IL-17B and IL-17F, and endothelial cells and proangiogenic cytokines in systemic lupus erythematosus patients.
23656167 2013 Association of IL-17, IL-21, and IL-23R gene polymorphisms with HBV infection in kidney transplant patients.
23652560 2013 Genetic polymorphisms of interleukin 17A and interleukin 17F and their association with inflammatory bowel disease in a Chinese Han population.
23616636 2013 IL-17-mediated M1/M2 macrophage alteration contributes to pathogenesis of bisphosphonate-related osteonecrosis of the jaws.
23614810 2013 Cytokine patterns differ seasonally between women with and without uterine leiomyomata.
23614478 2013 Epistatic interaction between genetic variants in susceptibility gene ETS1 correlates with IL-17 levels in SLE patients.
23613503 2013 Interleukin-17A expression in patients with chronic rhinosinusitis and its relationship with clinical features.
23596310 2013 IL-17 stimulates differentiation of human anti-inflammatory macrophages and phagocytosis of apoptotic neutrophils in response to IL-10 and glucocorticoids.
23555579 2013 Sputum IgE and cytokines in asthma: relationship with sputum cellular profile.
23555269 2013 Experimental human pneumococcal carriage augments IL-17A-dependent T-cell defence of the lung.
23546988 2014 Rheumatoid arthritis bone fragility is associated with upregulation of IL17 and DKK1 gene expression.
23529308 2013 Foxp3 and IL17 expression in tumor infiltrating lymphocytes (TIL) and tumor cells - correlated or independent factors?
23505558 2013 Decreased IL-7 responsiveness is related to oxidative stress in HIV disease.
23502338 2013 Increased IL-17A but decreased IL-27 serum levels in patients with multiple sclerosis.
23501056 2013 Functional interleukin-17 receptor A are present in the thyroid gland in intractable Graves disease.
23490420 2013 The effects of IL-17 upon human natural killer cells.
23485736 2013 Polymorphisms in immune/inflammatory cytokine genes are related to Parkinson's disease with cognitive impairment in the Han Chinese population.
23472658 2013 IL-23/IL-17A axis correlates with the nitric oxide pathway in inflammatory bowel disease: immunomodulatory effect of retinoic acid.
23460603 2014 Polymorphisms of interleukin-1 Beta and interleukin-17Alpha genes are associated with restless legs syndrome.
23451767 2014 Serum concentration of IL-17, IL-23 and TNF-? among patients with chronic spontaneous urticaria: association with disease activity and autologous serum skin test.
23448791 Reduction of CD68+ macrophages and decreased IL-17 expression in intestinal mucosa of patients with inflammatory bowel disease strongly correlate with endoscopic response and mucosal healing following infliximab therapy.
23448394 2013 Expression of interleukin-17 associated with disease progression and liver fibrosis with hepatitis B virus infection: IL-17 in HBV infection.
23444260 2013 Gastrokine 1 regulates NF-?B signaling pathway and cytokine expression in gastric cancers.
23421940 2013 IL-17-mediated Bcl-2 expression regulates survival of fibroblast-like synoviocytes in rheumatoid arthritis through STAT3 activation.
23416458 2013 Pitfalls in determining the cytokine profile of human T cells.
23414478 2013 Elevated IL-17A levels in early stages of bladder cancer regardless of smoking status.
23411595 2013 Analysis of CD137L and IL-17 expression in tumor tissue as prognostic indicators for gliblastoma.
23409930 2013 Loss of ROR?t DNA binding activity inhibits IL-17 expression in HIV-1 infected Indian individuals.
23401702 2013 IL-17A in human respiratory diseases: innate or adaptive immunity? Clinical implications.
23400328 2013 IL-17A/F modulates fibrocyte functions in cooperation with CD40-mediated signaling.
23388330 2013 [PD-L1/PD-L2 on human placenta-derived mesenchymal stem cells inhibits the IL-17 secretion of peripheral blood T cells].
23352235 2013 Human inflammatory dendritic cells induce Th17 cell differentiation.
23350952 Circulating IL-6, IL-17 and vitamin D in hepatocellular carcinoma: potential biomarkers for a more favorable prognosis?
23335253 2013 Interleukin-17A+ cell counts are increased in systemic sclerosis skin and their number is inversely correlated with the extent of skin involvement.
23334598 2013 The interleukin 17 system in cortical lesions in focal cortical dysplasias.
23327801 2013 The role of the IL-23/IL-17 axis in the pathogenesis of Graves' disease.
23323524 2013 IL-17 gene polymorphism is associated with chronic periodontitis and peri-implantitis in Iranian patients: a cross-sectional study.
23322904 2013 Inflammatory cytokines at the summits of pathological signal cascades in brain diseases.
23304063 2012 Association between polymorphisms in interleukin-17A and -17F genes and chronic periodontal disease.
23298391 2013 Another beneficial effect of rituximab on refractory ANCA-associated vasculitis: the role of interleukin-17 suppression?
23295184 2013 Negative feedback on IL-23 exerted by IL-17A during pulmonary inflammation.
23280722 2014 IL17A gene polymorphisms, serum IL-17A and IgE levels, and hepatocellular carcinoma risk in patients with chronic hepatitis B virus infection.
23274801 2013 IL-17 level in patients with Dengue virus infection & its association with severity of illness.
23274784 2013 IL-17A but not IL-22 suppresses the replication of hepatitis B virus mediated by over-expression of MxA and OAS mRNA in the HepG2.2.15 cell line.
23273903 2013 Longitudinal interferon-? effects in multiple sclerosis: differential regulation of IL-10 and IL-17A, while no sustained effects on IFN-?, IL-4 or IL-13.
23271701 2013 The role of inflammasome-derived IL-1 in driving IL-17 responses.
23269607 2013 Downregulation of IL-17-producing T cells is associated with regulatory T cell expansion and disease progression in chronic lymphocytic leukemia.
23262228 2013 IL-17 induces type V collagen overexpression and EMT via TGF-?-dependent pathways in obliterative bronchiolitis.
23257917 2013 Increased expression levels of integrin ?9?1 and CD11b on circulating neutrophils and elevated serum IL-17A in elderly aspiration pneumonia.
23238559 2013 Neutrophils, neutrophil extracellular traps and interleukin-17 associate with the organisation of thrombi in acute myocardial infarction.
23237940 2013 Increased Th17 cells and interleukin-17 contribute to immune activation and disease aggravation in patients with chronic hepatitis B virus infection.
23232337 2013 The Th1/Th2/Th17 cytokine profile of HIV-infected individuals: a multivariate cytokinomics approach.
23227158 2012 Elevated pretherapy serum IL17 in primary hepatocellular carcinoma patients correlate to increased risk of early recurrence after curative hepatectomy.
23226926 2012 IL-17 and IL-11 GCF levels in aggressive and chronic periodontitis patients: relation to PCR bacterial detection.
23226545 2012 Decreased levels of circulating IL17-producing CD161+CCR6+ T cells are associated with graft-versus-host disease after allogeneic stem cell transplantation.
23223131 2013 CD8(+) T cells in the lesional skin of atopic dermatitis and psoriasis patients are an important source of IFN-?, IL-13, IL-17, and IL-22.
23215950 2013 Imbalance of interleukin-17-producing CD4 T cells/regulatory T cells axis occurs in remission stage of patients with hepatitis B virus-related acute-on-chronic liver failure.
23207971 2013 Serum levels of IL-17A in patients with relapsing-remitting multiple sclerosis treated with interferon-?.
23204182 2013 High interleukin 17 expression is correlated with better cardiac function in human Chagas disease.
23192273 2013 IL-17A/IL-17RA interaction promoted metastasis of osteosarcoma cells.
23181791 2012 Human eosinophils release IL-1ß and increase expression of IL-17A in activated CD4+ T lymphocytes.
23158993 2012 [Expression of CD4(+) and IL-17, Foxp3 in non-small cell lung cancer and their correlation with microvessel density].
23148681 2012 IL-32 and IL-17 interact and have the potential to aggravate osteoclastogenesis in rheumatoid arthritis.
23147652 2012 Gene polymorphisms of interleukin-17 and interleukin-17 receptor are associated with end-stage kidney disease.
23137879 2013 Evaluation of IL17A expression and of IL17A, IL17F and IL23R gene polymorphisms in Brazilian individuals with periodontitis.
23131423 2013 Interleukin-17A genetic variants can confer resistance to brucellosis in Iranian population.
23101722 2013 Elevated levels of interleukin-27 and effect on production of interferon-? and interleukin-17 in patients with Behçet's disease.
23098499 2012 CD4+, IL17 and Foxp3 expression in different pTNM stages of operable non-small cell lung cancer and effects on disease prognosis.
23091305 2012 IL-17 and IL-22 in cerebrospinal fluid and plasma are elevated in Guillain-Barré syndrome.
23071273 2012 Human basophils interact with memory T cells to augment Th17 responses.
23049595 2012 Association between IL17 polymorphisms and risk of cervical cancer in Chinese women.
23034167 2012 Elevated levels of anti inflammatory IL-10 and pro inflammatory IL-17 in malignant pleural effusions.
23033269 2012 SOCS3 promotes interleukin-17 expression of human T cells.
23019580 2012 cAMP response element modulator ? controls IL2 and IL17A expression during CD4 lineage commitment and subset distribution in lupus.
23018031 2012 Dysregulation of miRNA146a versus IRAK1 induces IL-17 persistence in the psoriatic skin lesions.
23012664 2012 Association of genetic polymorphisms in IL17A and IL17F with gastro-duodenal diseases.
23009764 Interleukin-17A correlates with interleukin-6 production in human cystic echinococcosis: a possible involvement of IL-17A in immunoprotection against Echinococcus granulosus infection.
22993227 2013 Increased IL-17A expression in temporal artery lesions is a predictor of sustained response to glucocorticoid treatment in patients with giant-cell arteritis.
22989874 2012 CD3-T cell receptor co-stimulation through SLAMF3 and SLAMF6 receptors enhances ROR?t recruitment to the IL17A promoter in human T lymphocytes.
22989213 2012 IL-17A in the tumor microenvironment of the human colorectal adenoma-carcinoma sequence.
22984500 2012 Association of single nucleotide polymorphisms of IL23R and IL17 with ulcerative colitis risk in a Chinese Han population.
22974591 2012 Elevated serum level of type-2 cytokine and low IL-17 in first episode psychosis and schizophrenia in relapse.
22965992 2012 Experimental abdominal aortic aneurysm formation is mediated by IL-17 and attenuated by mesenchymal stem cell treatment.
22960198 2013 Interleukin-17A promotes rheumatoid arthritis synoviocytes migration and invasion under hypoxia by increasing MMP2 and MMP9 expression through NF-?B/HIF-1? pathway.
22955875 2013 IL-23A, IL-23R, IL-17A and IL-17R polymorphisms in different psoriatic arthritis clinical manifestations in the northern Italian population.
22955700 2013 Influence of IL17A polymorphisms (rs2275913 and rs3748067) on the susceptibility to ulcerative colitis.
22928014 2012 Blunted IL17/IL22 and pro-inflammatory cytokine responses in the genital tract and blood of HIV-exposed, seronegative female sex workers in Kenya.
22902077 2012 Possible role of Th17 cells and IL-17 in the pathogenesis of atopic dermatitis in northern China.
22902060 2012 Interleukin-17A is present in neutrophils in endometrioma and stimulates the secretion of growth-regulated oncogene-? (Gro-?) from endometrioma stromal cells.
22880090 2012 Variation of Mycobacterium tuberculosis antigen-specific IFN-? and IL-17 responses in healthy tuberculin skin test (TST)-positive human subjects.
22876724 2012 IL-17, neutrophil activation and muscle damage following endurance exercise.
22851868 2012 Vitamin D deficiency: correlation to interleukin-17, interleukin-23 and PIIINP in hepatitis C virus genotype 4.
22840497 2012 HIV-1 diseases progression associated with loss of Th17 cells in subtype 'C' infection.
22827846 2012 Influence of IL17A polymorphisms on the aberrant methylation of DAPK and CDH1 in non-cancerous gastric mucosa.
22825627 2012 Increased synovial expression of IL-27 by IL-17 in rheumatoid arthritis.
22819243 2012 TWEAK promotes the production of Interleukin-17 in rheumatoid arthritis.
22818182 2012 Osteopontin regulates interleukin-17 production in hepatitis.
22816799 2012 Association of interleukin-17A and -17F gene single-nucleotide polymorphisms with autoimmune thyroid diseases.
22814515 2012 Th1/Th2/Th17?related cytokines in the bronchoalveolar lavage fluid of patients with sarcoidosis: association with smoking.
22812212 2012 Variations in TGF-beta, IL-10, and IL-17 after specific immunotherapy and correlations with symptoms in patients with allergic rhinitis.
22808218 2012 IL-17A facilitates platelet function through the ERK2 signaling pathway in patients with acute coronary syndrome.
22800829 2012 Overexpression of interleukin-l7 in tumor-associated macrophages is correlated with the differentiation and angiogenesis of laryngeal squamous cell carcinoma.
22795370 2013 Patients with cystic fibrosis have inducible IL-17+IL-22+ memory cells in lung draining lymph nodes.
22789685 2012 Positive link between STAT3 activation and Th17 cell infiltration to the lesional skin in vitiligo vulgaris.
22759859 2012 Gene expression of cytokines (TNF-?, IFN-?), serum profiles of IL-17 and IL-23 in paediatric systemic lupus erythematosus.
22748016 2012 Elevated serum levels of interleukin-17A in children with autism.
22744708 2012 Expression of interleukin-17 and its clinical significance in gastric cancer patients.
22715389 2012 Effector CD4+ T cell expression signatures and immune-mediated disease associated genes.
22696687 2012 Activated and resting regulatory T cell exhaustion concurs with high levels of interleukin-22 expression in systemic sclerosis lesions.
22692973 2013 Interleukin-17 gene polymorphisms are associated with bladder cancer in a Chinese Han population.
22684574 2012 Implications of Th1 and Th17 cells in pathogenesis of oral lichen planus.
22683003 2012 Porphyromonas gingivalis lipopolysaccharide regulates interleukin (IL)-17 and IL-23 expression via SIRT1 modulation in human periodontal ligament cells.
22677045 2012 IL-17A is essential for cell activation and inflammatory gene circuits in subjects with psoriasis.
22660635 2012 The microRNA miR-23b suppresses IL-17-associated autoimmune inflammation by targeting TAB2, TAB3 and IKK-?.
22655909 2012 Circulating Th17 cells are not elevated in patients with chronic heart failure.
22647601 2012 Peroxisome proliferator-activated receptor (PPAR)? and -? regulate IFN? and IL-17A production by human T cells in a sex-specific way.
22641009 Decreased RNA expression of interleukin 17A in skin of leprosy.
22629719 2011 [Dynamics of serum IL-17A, IL-17F and IL-23 in patients with inflammatory bowel disease].
22627363 2012 NFAT1 and NFAT2 differentially regulate IL-17A expression in human T cells.
22585726 2012 Specific increase in local IL-17 production during recovery from primary RSV bronchiolitis.
22563781 2012 Allergen-specific responses of CD19(high) and CD19(low) B Cells in Non-IgE-mediated food allergy of late eczematous reactions in atopic dermatitis: presence of IL-17- and IL-32-producing regulatory B cells (Br17 & Br32).
22559912 2013 Increased activity of interleukin-23/interleukin-17 cytokine axis in primary antiphospholipid syndrome.
22541406 2012 Contribution of interleukin 17A to the development and regulation of allergic inflammation in a murine allergic rhinitis model.
22537748 2012 Genetic polymorphisms of IL17A and pri-microRNA-938, targeting IL17A 3'-UTR, influence susceptibility to gastric cancer.
22534817 2012 Interleukin-17 and prostaglandin E2 are involved in formation of an M2 macrophage-dominant microenvironment in lung cancer.
22532631 2012 IL-17 and tumour necrosis factor ? combination induces a HIF-1?-dependent invasive phenotype in synoviocytes.
22527432 2012 Lessons of leprosy: the emergence of TH17 cytokines during type II reactions (ENL) is teaching us about T-cell plasticity.
22507625 2012 Association between polymorphisms in cytokine genes IL-17A and IL-17F and development of allergic rhinitis and comorbid asthma in Chinese subjects.
22496194 2012 Increased muscle expression of interleukin-17 in Duchenne muscular dystrophy.
22483685 2012 Interactions between IL17A, IL23R, and STAT4 polymorphisms confer susceptibility to intestinal Behcet's disease in Korean population.
22466961 2012 Synergism between interleukin (IL)-17 and Toll-like receptor 2 and 4 signals to induce IL-8 expression in cystic fibrosis airway epithelial cells.
22464815 2013 Mesenchymal stem cells promote neutrophil activation by inducing IL-17 production in CD4+ CD45RO+ T cells.
22462422 2012 The role of interleukin (IL)-17 in anxiety and depression of patients with rheumatoid arthritis.
22461912 2012 Association analysis of IL-17A and IL-17F polymorphisms in Chinese Han women with breast cancer.
22444300 2012 Clinical significance of the ratio between FOXP3 positive regulatory T cell and interleukin-17 secreting cell in renal allograft biopsies with acute T-cell-mediated rejection.
22442208 2012 Renal IL-17 expression in human ANCA-associated glomerulonephritis.
22419580 2012 Production of the effector cytokine interleukin-17, rather than interferon-?, is more strongly associated with autoimmune hemolytic anemia.
22417709 2012 TLR2 ligation induces the production of IL-23/IL-17 via IL-6, STAT3 and NF-kB pathway in patients with primary Sjogren's syndrome.
22395503 2012 IL-17 patterns in synovium, serum and synovial fluid from treatment-naïve, early rheumatoid arthritis patients.
22362575 2013 Role of IL-17 in psoriasis and psoriatic arthritis.
22312940 2011 Interleukin 17A and F and asthma in Saudi Arabia: gene polymorphisms and protein levels.
22302060 2012 IL-7 drives Th1 and Th17 cytokine production in patients with primary SS despite an increase in CD4 T cells lacking the IL-7R?.
22262980 2012 Expression of IL-17, IL-23 and their receptors in minor salivary glands of patients with primary Sjögren's syndrome.
22261033 2012 Cigarette smoke induction of osteopontin (SPP1) mediates T(H)17 inflammation in human and experimental emphysema.
22258491 2012 Combination of IL-17 and TNF? induces a pro-inflammatory, pro-coagulant and pro-thrombotic phenotype in human endothelial cells.
22237416 2012 A novel isoform of the orphan receptor ROR?t suppresses IL-17 production in human T cells.
22235998 2012 Up-regulation of small intestinal interleukin-17 immunity in untreated coeliac disease but not in potential coeliac disease or in type 1 diabetes.
22229441 2012 IL-17 downregulates filaggrin and affects keratinocyte expression of genes associated with cellular adhesion.
22219320 2012 Induction of endothelial nitric oxide synthase expression by IL-17 in human vascular endothelial cells: implications for vascular remodeling in transplant vasculopathy.
22219048 2012 A distinct regulatory role of Th17 cytokines IL-17A and IL-17F in chemokine secretion from lung microvascular endothelial cells.
22207110 2012 The role of Interleukin-17A and Interleukin-17E in multiple myeloma patients.
22191467 2012 Low interleukin-17A production in response to fungal pathogens in patients with chronic granulomatous disease.
22186234 The characterization of IL-17A expression in patients with chronic rhinosinusitis with nasal polyps.
22171994 2011 IL-17 induces AKT-dependent IL-6/JAK2/STAT3 activation and tumor progression in hepatocellular carcinoma.
22138182 2012 Tristetraprolin down-regulates IL-17 through mRNA destabilization.
22123380 2011 IL-13 and IL-17A gene polymorphisms in Japanese patients with aspirin-exacerbated respiratory disease.
22123224 2012 IL-17A and IL-17F expression in B lymphocytes.
22082565 2012 Increased IL-17-producing CD4(+) T cells in patients with esophageal cancer.
22079540 2012 Analysis of IL-6, IL-10 and IL-17 genetic polymorphisms as risk factors for sepsis development in burned patients.
22051182 2011 Distribution, characterization, and induction of CD8+ regulatory T cells and IL-17-producing CD8+ T cells in nasopharyngeal carcinoma.
22048239 2011 IL-22, but not IL-17, dominant environment in cutaneous T-cell lymphoma.
22042699 2011 miR-135b mediates NPM-ALK-driven oncogenicity and renders IL-17-producing immunophenotype to anaplastic large cell lymphoma.
22035960 2011 Th17 expansion in MS patients is counterbalanced by an expanded CD39+ regulatory T cell population during remission but not during relapse.
22031591 2012 Hepatic haemangiomas: possible association with IL-17.
22028838 2011 A genetic variant in the IL-17 promoter is functionally associated with acute graft-versus-host disease after unrelated bone marrow transplantation.
22026963 2011 IL17A genetic variation is associated with altered susceptibility to Gram-positive infection and mortality of severe sepsis.
22025620 2011 cAMP-responsive element modulator (CREM)? protein induces interleukin 17A expression and mediates epigenetic alterations at the interleukin-17A gene locus in patients with systemic lupus erythematosus.
22020264 2012 Intracellular detection of interleukin 17 and other cytokines in human bronchoalveolar lavage fluid: a first assessment.
21998454 2011 Ex vivo IL-1 receptor type I expression in human CD4+ T cells identifies an early intermediate in the differentiation of Th17 from FOXP3+ naive regulatory T cells.
21996293 2011 Increased frequency of circulating Th22 in addition to Th17 and Th2 lymphocytes in systemic sclerosis: association with interstitial lung disease.
21996014 2011 Increased interleukin (IL)-8 and decreased IL-17 production in chronic obstructive pulmonary disease (COPD) provoked by cigarette smoke.
21994045 2012 Compartmentalized expression of Th1 and Th17 cytokines in pediatric inflammatory bowel diseases.
21984702 2011 Epidermal CCR6+ ?? T cells are major producers of IL-22 and IL-17 in a murine model of psoriasiform dermatitis.
21982596 2011 Pivotal role of dermal IL-17-producing ?? T cells in skin inflammation.
21980832 2011 Significance of interleukin-17A in patients with nasal polyposis.
21977994 2011 Helper T-cell differentiation and plasticity: insights from epigenetics.
21972211 2011 The levels of IL-17A and of the cytokines involved in Th17 cell commitment are increased in patients with chronic immune thrombocytopenia.
21968742 2012 Interleukin-17-positive mast cells contribute to synovial inflammation in spondylarthritis.
21966367 2011 Immune response to Bifidobacterium bifidum strains support Treg/Th17 plasticity.
21964025 2011 IL-17 boosts proinflammatory outcome of antiviral response in human cells.
21960179 2012 Role of osteoclasts and interleukin-17 in the pathogenesis of rheumatoid arthritis: crucial 'human osteoclastology'.
21959034 2011 Increase in IL-21 producing T-cells in patients with systemic lupus erythematosus.
21949768 2011 Involvement of CCR6/CCL20/IL-17 axis in NSCLC disease progression.
21949691 2011 Suppression of inflammatory immune responses in celiac disease by experimental hookworm infection.
21949023 2011 The link between the PDL1 costimulatory pathway and Th17 in fetomaternal tolerance.
21943235 2011 Elevated levels of circulating IL-7 and IL-15 in patients with early stage prostate cancer.
21929599 2011 Increased serum interleukin-17 and peripheral Th17 cells in children with acute Henoch-Schönlein purpura.
21926059 2011 An imbalance in interleukin-17-producing T and Foxp3? regulatory T cells in women with idiopathic recurrent pregnancy loss.
21911461 2011 Active trachoma is associated with increased conjunctival expression of IL17A and profibrotic cytokines.
21904631 2011 IL-17 Expression by macrophages is associated with proliferative inflammatory atrophy lesions in prostate cancer patients.
21897004 2011 Prognostic values of serum IP-10 and IL-17 in patients with pulmonary tuberculosis.
21896776 2011 Role of interleukin-23 (IL-23) receptor signaling for IL-17 responses in human Lyme disease.
21894475 2012 Circulating IL-17 levels during the peri-transplant period as a predictor for early leukemia relapse after myeloablative allogeneic stem cell transplantation.
21887369 2011 IL-17A expression is localised to both mononuclear and polymorphonuclear synovial cell infiltrates.
21872532 2011 IL-17 induces apoptosis of vascular endothelial cells: a potential mechanism for human acute coronary syndrome.
21865860 2011 Higher infiltration by Th17 cells compared with regulatory T cells is associated with severe acute T-cell-mediated graft rejection.
21828034 2012 Interleukin-17A induces glucocorticoid insensitivity in human bronchial epithelial cells.
21798287 2011 IL-17 increases cadherin-11 expression in a model of autoimmune experimental arthritis and in rheumatoid arthritis.
21796151 2011 IL-17A upregulates keratin 17 expression in keratinocytes through STAT1- and STAT3-dependent mechanisms.
21795048 2011 Interleukin-17-secreting T cells in neuromyelitis optica and multiple sclerosis during relapse.
21785272 2011 Effects of IL-17A on the occurrence of lung adenocarcinoma.
21781514 2011 [Correlation between the airway inflammations and levels of stromal cell-derived factor 1 in induced sputum of asthmatic patients].
21762495 2011 Complement component C5a promotes expression of IL-22 and IL-17 from human T cells and its implication in age-related macular degeneration.
21761512 2011 Interleukin 17 gene and protein expression are increased in patients with ulcerative colitis.
21760911 2011 Interleukin 17A promotes hepatocellular carcinoma metastasis via NF-kB induced matrix metalloproteinases 2 and 9 expression.
21755509 2011 Increased serum interleukin-17 levels in patients with myasthenia gravis.
21752104 2011 Interleukin-17 positive cells accumulate in renal allografts during acute rejection and are independent predictors of worse graft outcome.
21749686 2011 The expression of the receptor for advanced glycation end-products (RAGE) in RA-FLS is induced by IL-17 via Act-1.
21746882 2011 1,25-dihydroxyvitamin D(3) ameliorates Th17 autoimmunity via transcriptional modulation of interleukin-17A.
21741035 2011 B cell infiltration is associated with the increased IL-17 and IL-22 expression in the lungs of patients with tuberculosis.
21737283 2011 Susceptible gene single nucleotide polymorphism and hemorrhage risk in patients with brain arteriovenous malformation.
21732985 2011 Patients with palmoplantar pustulosis have increased IL-17 and IL-22 levels both in the lesion and serum.
21721104 2011 Reduced expression of transforming growth factor-?1 and correlated elevation of interleukin-17 and interferon-? in pediatric patients with chronic primary immune thrombocytopenia (ITP).
21710691 2011 The molecular pathogenesis of STAT3-driven gastric tumourigenesis in mice is independent of IL-17.
21691744 2012 Methotrexate attenuates the Th17/IL-17 levels in peripheral blood mononuclear cells from healthy individuals and RA patients.
21689402 2011 Analysis of IL-17(+) cells in facet joints of patients with spondyloarthritis suggests that the innate immune pathway might be of greater relevance than the Th17-mediated adaptive immune response.
21685328 2011 Notch signaling regulates mouse and human Th17 differentiation.
21674477 2011 Interleukin-17-educated monocytes suppress cytotoxic T-cell function through B7-H1 in hepatocellular carcinoma patients.
21672939 2011 Genetic polymorphisms of IL-23R and IL-17A and novel insights into their associations with inflammatory bowel disease.
21659501 2011 Peripheral and islet interleukin-17 pathway activation characterizes human autoimmune diabetes and promotes cytokine-mediated ?-cell death.
21654831 2011 Foxp3+ regulatory T cells of psoriasis patients easily differentiate into IL-17A-producing cells and are found in lesional skin.
21654633 2011 Neither IL-17A mRNA nor IL-17A protein are detectable in Langerhans cell histiocytosis lesions.
21651870 2011 [Change and significance of Th17 cells and its secretive IL-17 in patients with autoimmune hemolytic anemia].
21641076 2011 Expression of the IL-23/Th17 pathway in lesions of hidradenitis suppurativa.
21637854 2011 Expression of miRNAs miR-133b and miR-206 in the Il17a/f locus is co-regulated with IL-17 production in ?? and ?? T cells.
21625016 2011 Expression of IL-17 and COX2 gene in peripheral blood leukocytes of vitiligo patients.
21606249 2011 Mast cells and neutrophils release IL-17 through extracellular trap formation in psoriasis.
21602493 2011 Inflammatory cytokines IL-32 and IL-17 have common signaling intermediates despite differential dependence on TNF-receptor 1.
21573786 2011 Regulation and function of IL-17A- and IL-22-producing ?? T cells.
21546069 2011 Asthma-associated polymorphisms in 17q21 influence cord blood ORMDL3 and GSDMA gene expression and IL-17 secretion.
21530504 2011 Lentivirus mediated IL-17R blockade improves diastolic cardiac function in spontaneously hypertensive rats.
21530487 2011 IL-17A increases ADP-induced platelet aggregation.
21528751 2010 T helper 17 cell population in lupus erythematosus.
21526159 2011 Interleukin-17 contributes to the pathogenesis of autoimmune hepatitis through inducing hepatic interleukin-6 expression.
21524680 2011 Antagonistic RNA aptamer specific to a heterodimeric form of human interleukin-17A/F.
21521755 2011 Interleukin-17A differentially modulates BCG induction of cytokine production in human blood macrophages.
21518507 2011 [Expression and significance of interleukin-23 and its related cytokines in chronic idiopathic thrombocytopenic purpura].
21505189 2011 Differentiation, phenotype, and function of interleukin-17-producing human V?9V?2 T cells.
21498517 2011 Distinct roles of transforming growth factor-beta-activated kinase 1 (TAK1)-c-Rel and interferon regulatory factor 4 (IRF4) pathways in human T cell lymphotropic virus 1-transformed T helper 17 cells producing interleukin-9.
21478400 2011 Proinflammatory environment dictates the IL-17-producing capacity of human invariant NKT cells.
21477350 2011 CD8 positive T cells express IL-17 in patients with chronic obstructive pulmonary disease.
21474820 2011 Role of interleukin 17 in inflammation, atherosclerosis, and vascular function in apolipoprotein e-deficient mice.
21455110 2011 Expression of Th-17 and ROR?t mRNA in Behçet's Disease.
21447959 2011 IL-17A induces CCL28, supporting the chemotaxis of IgE-secreting B cells.
21440743 2011 Serum levels of interleukin (IL)-10, IL-17, transforming growth factor (TGF)-?1, and interferon-? cytokines and expression levels of IL-10 and TGF-?1 genes in renal allograft recipients after donor bone marrow cell infusion.
21426710 2011 [Relationship between allergic symptoms and RORC2 and IL-17 in patients with allergic rhinitis].
21396350 2011 IL-17 is associated with poor prognosis and promotes angiogenesis via stimulating VEGF production of cancer cells in colorectal carcinoma.
21369705 2011 Tumor-infiltrating CD4+ Th17 cells produce IL-17 in tumor microenvironment and promote tumor progression in human gastric cancer.
21357259 2011 IL-17+ regulatory T cells in the microenvironments of chronic inflammation and cancer.
21346774 2011 Malignant cutaneous T-cell lymphoma cells express IL-17 utilizing the Jak3/Stat3 signaling pathway.
21294892 2011 A polymorphism in the interleukin-4 receptor affects the ability of interleukin-4 to regulate Th17 cells: a possible immunoregulatory mechanism for genetic control of the severity of rheumatoid arthritis.
21294864 2011 Dual role of interleukin-17 in pannus growth and osteoclastogenesis in rheumatoid arthritis.
21292197 2011 Kinetics and involvement of interleukin-17 in the outcome of peritonitis in nondiabetic patients undergoing peritoneal dialysis.
21282514 2011 IL-17A and TNF-? exert synergistic effects on expression of CXCL5 by alveolar type II cells in vivo and in vitro.
21248258 2011 Th17 cells expressing KIR3DL2+ and responsive to HLA-B27 homodimers are increased in ankylosing spondylitis.
21245272 2011 Staphylococcal alpha-toxin is a strong inducer of interleukin-17 in humans.
21236478 2011 Human TH17 cells express a functional IL-13 receptor and IL-13 attenuates IL-17A production.
21231819 2011 Interleukin-17 and interleukin-23 in patients with polymyositis and dermatomyositis.
21225222 2011 IL-17 expression is correlated with hepatitis B?related liver diseases and fibrosis.
21217785 2011 A single nucleotide polymorphism of IL-17 gene in the recipient is associated with acute GVHD after HLA-matched unrelated BMT.
21217016 2011 Th17 cells, not IL-17+ ?? T cells, drive arthritic bone destruction in mice and humans.
21204897 2011 Interleukin-15 induces interleukin-17 production by synovial T cell lines from patients with rheumatoid arthritis.
21196925 2010 Growth hormone-releasing hormone stimulates the secretion of interleukin 17 from human peripheral blood mononuclear cells in vitro.
21189442 2010 Interleukin-17A and interleukin-17F mRNA expression in peripheral blood mononuclear cells of patients with multiple sclerosis.
21182094 2011 Increased IL-17A secretion in response to Candida albicans in autoimmune polyendocrine syndrome type 1 and its animal model.
21181220 2011 Th-17 associated cytokines in patients with reactive arthritis/undifferentiated spondyloarthropathy.
21178008 2011 Restricted microbiota and absence of cognate TCR antigen leads to an unbalanced generation of Th17 cells.
21161669 2011 Increased serum IL-17 and IL-23 in the patient with ankylosing spondylitis.
21145111 2011 IL-17R activation of human periodontal ligament fibroblasts induces IL-23 p19 production: Differential involvement of NF-?B versus JNK/AP-1 pathways.
21143945 2010 Elevated expression of both mRNA and protein levels of IL-17A in sputum of stable Cystic Fibrosis patients.
21129248 2010 [Expression and clinical significance of IL-17 and IL-21 in patients with acute leukemia].
21124836 2010 Overrepresentation of IL-17A and IL-22 producing CD8 T cells in lesional skin suggests their involvement in the pathogenesis of psoriasis.
21116822 2011 Expression of IL-17A in human atherosclerotic lesions is associated with increased inflammation and plaque vulnerability.
21116820 2012 Increased plasma levels of IL-21 and IL-23 in spondyloarthritis are not associated with clinical and MRI findings.
21109552 2011 Raised interleukin-17 is immunolocalised to neutrophils in cystic fibrosis lung disease.
21103795 2010 The possible role of IL-17 in obesity-associated cancer.
21091665 2011 Forkhead box P3+ T cells express interleukin-17 in nasal mucosa of patients with both allergic rhinitis and polyposis.
21062626 2011 Interleukin-17A gene variants and risk of coronary artery disease: a large angiography-based study.
21062492 2010 IL-17A is increased in the serum and in spinal cord CD8 and mast cells of ALS patients.
21060663 2010 The presence of IL-17A and T helper 17 cells in experimental mouse brain tumors and human glioma.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
21044126 2010 IL-17A and IL-17F gene expression is strongly induced in the mucosa of H. pylori-infected subjects from Kenya and Germany.
21029245 2011 Study on the relationship between Th17 cells and unexplained recurrent spontaneous abortion.
20976193 2010 Early production of IL-22 but not IL-17 by peripheral blood mononuclear cells exposed to live Borrelia burgdorferi: the role of monocytes and interleukin-1.
20974984 2010 STAT1-activating cytokines limit Th17 responses through both T-bet-dependent and -independent mechanisms.
20952660 2011 Foxp3+IL-17+ T cells promote development of cancer-initiating cells in colorectal cancer.
20889558 2010 Host defense mechanisms in secondary syphilitic lesions: a role for IFN-gamma-/IL-17-producing CD8+ T cells?
20874252 2010 Regulatory effects of interferon-? on osteopontin and interleukin-17 expression in multiple sclerosis.
20856230 2011 IL17: potential therapeutic target in Sjögren's syndrome using adenovirus-mediated gene transfer.
20848848 2010 [Detection of the serum level of interleukin-17 and interleukin-6 in the chronic hepatitis B patients].
20840794 2010 MicroRNA-146a expresses in interleukin-17 producing T cells in rheumatoid arthritis patients.
20825419 2010 Role of interleukin-17 in lymphangiogenesis in non-small-cell lung cancer: Enhanced production of vascular endothelial growth factor C in non-small-cell lung carcinoma cells.
20814021 2010 Interleukin-17-dependent autoimmunity to collagen type V in atherosclerosis.
20812962 2010 Primary human keratinocytes efficiently induce IL-1-dependent IL-17 in CCR6+ T cells.
20810982 2010 Cutting edge: Increased IL-17-secreting T cells in children with new-onset type 1 diabetes.
20720207 2010 Inflammatory effects of ex vivo human Th17 cells are suppressed by regulatory T cells.
20718783 2010 The T helper type 17/regulatory T cell imbalance in patients with acute Kawasaki disease.
20685755 2010 The deregulation of regulatory T cells on interleukin-17-producing T helper cells in patients with unexplained early recurrent miscarriage.
20682672 2010 The relation of interleukin 17 (IL-17) and IL-23 to Th1/Th2 cytokines and disease activity in systemic lupus erythematosus.
20667562 2011 Decreased serum interleukin-17 and increased transforming growth factor-? levels in subjects with metabolic syndrome (Chennai Urban Rural Epidemiology Study-95).
20665551 2011 Interleukin-17 synergizes with IFN? or TNF? to promote inflammatory mediator release and intercellular adhesion molecule-1 (ICAM-1) expression in human intervertebral disc cells.
20664052 2010 A novel role of IL-17-producing lymphocytes in mediating lytic bone disease in multiple myeloma.
20646637 2010 [Interleukin-17 expression and significance in normal lung function smokers and chronic obstructive pulmonary disease patients].
20624941 2010 Candida albicans dampens host defense by downregulating IL-17 production.
20620187 2010 Interleukin-17 gene polymorphism is associated with Vogt-Koyanagi-Harada syndrome but not with Behçet's disease in a Chinese Han population.
20618180 2011 IL-17 increased in the third trimester in healthy women with term labor.
20596087 2010 Interleukin-17A promotes IgE production in human B cells.
20596075 2010 Regulation of interleukin-1beta by interferon-gamma is species specific, limited by suppressor of cytokine signalling 1 and influences interleukin-17 production.
20592279 2010 IL-17 immunity in human type 1 diabetes.
20581151 2010 Tumor-activated monocytes promote expansion of IL-17-producing CD8+ T cells in hepatocellular carcinoma patients.
20563617 2010 The imbalance between regulatory and IL-17-secreting CD4+ T cells in lupus patients.
20533542 2010 Role of osteopontin in synovial Th17 differentiation in rheumatoid arthritis.
20515574 The role of T-helper 17 (Th17) cells in patients with medulloblastoma.
20511558 2010 Human Th17 cells comprise heterogeneous subsets including IFN-gamma-producing cells with distinct properties from the Th1 lineage.
20511548 2010 Mesenchymal stem cells inhibit human Th17 cell differentiation and function and induce a T regulatory cell phenotype.
20506642 2010 [The expression of interleukin-17 in blood and nasal tissue of patients with allergic rhinltis and nasal polyps].
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20493423 2010 IL-17 in cutaneous lupus erythematosus.
20445554 2010 IL-17A has an important role in the acute attacks of Behçet's disease.
20437253 2010 The polymorphism of IL-17 G-152A was associated with childhood asthma and bacterial colonization of the hypopharynx in bronchiolitis.
20418110 2010 Polymorphisms in cytokine genes and serum cytokine levels among New Mexican women with and without breast cancer.
20395418 2010 Elevated IL-17 produced by TH17 cells promotes myeloma cell growth and inhibits immune function in multiple myeloma.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20357258 2010 IL-17 amplifies human contact hypersensitivity by licensing hapten nonspecific Th1 cells to kill autologous keratinocytes.
20357253 2010 Intragraft Th17 infiltrate promotes lymphoid neogenesis and hastens clinical chronic rejection.
20352428 2010 Th17 cells: positive or negative role in tumor?
20350814 2010 IL-17 is elevated in cerebrospinal fluids in bacterial meningitis in children.
20339909 2011 Impact of interleukin-17 on macrophage phagocytosis of apoptotic neutrophils and particles.
20334681 2010 Dysregulated balance of Th17 and Th1 cells in systemic lupus erythematosus.
20306850 2010 [The expression and significance of interleukin-17 and the infiltrating eosinophils in nasal polyps and nasal mucous of allergic rhinitis].
20305686 2010 Th17 cells and their associated cytokines in liver diseases.
20299682 2010 Mycobacterium tuberculosis induces IL-17A responses through TLR4 and dectin-1 and is critically dependent on endogenous IL-1.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20228201 2010 Differential IL-17 production and mannan recognition contribute to fungal pathogenicity and commensalism.
20228199 2010 IL-17-mediated monocyte migration occurs partially through CC chemokine ligand 2/monocyte chemoattractant protein-1 induction.
20228195 2010 IL-17 promotes p38 MAPK-dependent endothelial activation enhancing neutrophil recruitment to sites of inflammation.
20207161 2010 Transforming growth factor beta-1 and interleukin-17 gene transcription in peripheral blood mononuclear cells and the human response to infection.
20200272 2010 Mast cells express IL-17A in rheumatoid arthritis synovium.
20185422 2010 Interleukin-17-producing T-helper cells and related cytokines in human airways exposed to endotoxin.
20173782 2010 Prognostic significance of genetic variants in the IL-23/Th17 pathway for the outcome of T cell-depleted allogeneic stem cell transplantation.
20173024 2010 IL-17 contributes to angiogenesis in rheumatoid arthritis.
20167120 2010 Interleukin-17A upregulates receptor activator of NF-kappaB on osteoclast precursors.
20159251 2010 Evidence for altered activity of the IL-6 pathway in chronic rhinosinusitis with nasal polyps.
20127054 2010 Association between IL-17A, -17F and MIF polymorphisms predispose to CpG island hyper-methylation in gastric cancer.
20112373 2010 Tumor necrosis factor alpha blockade exacerbates murine psoriasis-like disease by enhancing Th17 function and decreasing expansion of Treg cells.
20107878 2010 Plasma IL-17A is increased in new-onset SLE patients and associated with disease activity.
20106535 2010 Increased prevalence of T helper 17 (Th17) cells in peripheral blood and decidua in unexplained recurrent spontaneous abortion patients.
20099977 2010 Interleukin-17 may be a valuable serum tumor marker in patients with colorectal carcinoma.
20070409 2010 Toll-like receptor 6 drives interleukin-17A expression during experimental hypersensitivity pneumonitis.
20061410 2010 Characterization of IL-17A-producing cells in celiac disease mucosa.
20042592 2010 IL-17 regulates CXCL1 mRNA stability via an AUUUA/tristetraprolin-independent sequence.
20032993 2010 Circulating Th17, Th22, and Th1 cells are increased in psoriasis.
20026744 2010 Human plasmacytoid dendritic cells support Th17 cell effector function in response to TLR7 ligation.
20026736 2010 Tumor microenvironments direct the recruitment and expansion of human Th17 cells.
20022135 2010 Increased IL-17-producing cells correlate with poor survival and lymphangiogenesis in NSCLC patients.
20016509 2010 Mixed results with modulation of TH-17 cells in human autoimmune diseases.
19969371 2010 A role for IL-17 in induction of an inflammation at the fetomaternal interface in preterm labour.
19968632 2010 Opposing roles of IL-17A and IL-25 in the regulation of TSLP production in human nasal epithelial cells.
19940509 2010 Differential mucosal IL-17 expression in two gliadin-induced disorders: gluten sensitivity and the autoimmune enteropathy celiac disease.
19936899 2010 Foxp3+ regulatory T cells, Th17 effector cells, and cytokine environment in inflammatory bowel disease.
19931506 2010 IL-17 primes airway epithelial cells lacking functional Cystic Fibrosis Transmembrane conductance Regulator (CFTR) to increase NOD1 responses.
19929695 2010 Regulatory T cells modulate Th17 responses in patients with positive tuberculin skin test results.
19917178 Relationship between gamma-interferon and interleukin-17 in Chlamydia trachomatis reactive arthritis.
19912252 2010 Translational mini-review series on Th17 cells: function and regulation of human T helper 17 cells in health and disease.
19912251 2010 Translational mini-review series on Th17 cells: induction of interleukin-17 production by regulatory T cells.
19912249 2010 Translational mini-review series on Th17 cells: CD4 T helper cells: functional plasticity and differential sensitivity to regulatory T cell-mediated regulation.
19912248 2010 Translational mini-review series on Th17 cells: development of mouse and human T helper 17 cells.
19907660 2009 Tumor-like stem cells derived from human keloid are governed by the inflammatory niche driven by IL-17/IL-6 axis.
19904747 2010 Association between polymorphisms in interleukin-17A and interleukin-17F genes and risks of gastric cancer.
19895848 2010 IL-10 suppresses Th17 cells and promotes regulatory T cells in the CD4+ T cell population of rheumatoid arthritis patients.
19878510 2010 Milder clinical hyperimmunoglobulin E syndrome phenotype is associated with partial interleukin-17 deficiency.
19861249 2009 [Role of interleukin 17 in viral myocarditis and dilated cardiomyopathy].
19857751 2009 Differential effect of cyclosporine and mycophenolic acid on the human regulatory T cells and TH-17 cells balance.
19844129 2010 Th17 immunity in patients with allergic asthma.
19843935 2009 Phenotypical characterization of human Th17 cells unambiguously identified by surface IL-17A expression.
19838198 2009 Structural basis of receptor sharing by interleukin 17 cytokines.
19835883 2009 Structure of IL-17A in complex with a potent, fully human neutralizing antibody.
19830738 2009 The Th17 cytokine IL-22 induces IL-20 production in keratinocytes: a novel immunological cascade with potential relevance in psoriasis.
19825828 2009 Act1, a U-box E3 ubiquitin ligase for IL-17 signaling.
19822653 2010 Superantigenic Staphylococcus aureus stimulates production of interleukin-17 from memory but not naive T cells.
19797506 2009 Monocyte derived interleukin (IL)-23 is an important determinant of synovial IL-17A expression in rheumatoid arthritis.
19748982 2009 Monocytes from patients with type 1 diabetes spontaneously secrete proinflammatory cytokines inducing Th17 cells.
19741298 2009 The tumor-promoting actions of TNF-alpha involve TNFR1 and IL-17 in ovarian cancer in mice and humans.
19741026 2010 Interleukin-17A activation on bronchial epithelium and basophils: a novel inflammatory mechanism.
19737863 2009 Loss of SOCS3 expression in T cells reveals a regulatory role for interleukin-17 in atherosclerosis.
19728295 2009 IL-17 induces osteoclastogenesis from human monocytes alone in the absence of osteoblasts, which is potently inhibited by anti-TNF-alpha antibody: a novel mechanism of osteoclastogenesis by IL-17.
19724898 2009 Effect of polymorphisms of IL-17A, -17F and MIF genes on CpG island hyper-methylation (CIHM) in the human gastric mucosa.
19700754 2009 Systemic and local interleukin-17 and linked cytokines associated with Sjögren's syndrome immunopathogenesis.
19692128 2009 Encephalitogenic T cells that stably express both T-bet and ROR gamma t consistently produce IFNgamma but have a spectrum of IL-17 profiles.
19672092 2010 Role of interleukin-17A in the eosinophil accumulation and mucosal remodeling in chronic rhinosinusitis with nasal polyps associated with asthma.
19628296 2009 Interleukin-17 regulates chemokine and gelatinase B expression in fibroblasts to recruit both neutrophils and monocytes.
19627579 2009 Human rheumatoid arthritis tissue production of IL-17A drives matrix and cartilage degradation: synergy with tumour necrosis factor-alpha, Oncostatin M and response to biologic therapies.
19620772 2009 IL-17 and IL-22 are associated with protection against human kala azar caused by Leishmania donovani.
19589271 Myeloperoxidase (MPO) and interleukin-17 (IL-17) plasma levels are increased in patients with acute coronary syndromes.
19587005 2009 NKG2D-dependent IL-17 production by human T cells in response to an intracellular pathogen.
19566585 2010 Clinical outcome and IL-17, IL-23, IL-27 and FOXP3 expression in peripheral blood mononuclear cells of pollen-allergic children during sublingual immunotherapy.
19550095 2009 Exploring the role of Th1 cytokines: interleukin-17 and interleukin-18 in periodontal health and disease.
19545679 2009 Interleukin-17 and kidney allograft outcome.
19543237 2009 IL-17 stimulates the proliferation and differentiation of human mesenchymal stem cells: implications for bone remodeling.
19536281 2009 The pronounced Th17 profile in systemic sclerosis (SSc) together with intracellular expression of TGFbeta and IFNgamma distinguishes SSc phenotypes.
19535626 2009 TGF-beta promotes Th17 cell development through inhibition of SOCS3.
19487306 2009 IL-17-producing CD8+ T lymphocytes from psoriasis skin plaques are cytotoxic effector cells that secrete Th17-related cytokines.
19485773 2010 Does IL-17 play a role in hepatic dysfunction of scrub typhus patients?
19479869 2009 Frequency and phenotype of peripheral blood Th17 cells in ankylosing spondylitis and rheumatoid arthritis.
19479806 2009 Changes in the serum levels of interleukin-17/interleukin-23 during acute rejection in liver transplantation.
19476435 2009 Interleukin 17 production among patients with American cutaneous leishmaniasis.
19476112 2009 Expression or secretion of IL-17 in the peripheral blood mononuclear cells from patients with dilated cardiomyopathy.
19457169 2009 Hypoxia enhances stimulating effect of amyloid beta peptide (25-35) for interleukin 17 and T helper lymphocyte subtype 17 upregulation in cultured peripheral blood mononuclear cells.
19439651 2009 Human memory FOXP3+ Tregs secrete IL-17 ex vivo and constitutively express the T(H)17 lineage-specific transcription factor RORgamma t.
19431078 2009 The IL-12/IL-23 axis and its role in Th17 cell development, pathology and plasticity in arthritis.
19428338 2009 Interleukin-17A inhibits adipocyte differentiation in human mesenchymal stem cells and regulates pro-inflammatory responses in adipocytes.
19426392 2009 Association of the CagA status of Helicobacter pylori and serum levels of interleukin (IL)-17 and IL-23 in duodenal ulcer patients.
19424201 2009 Interleukin-17A is not expressed by CD207(+) cells in Langerhans cell histiocytosis lesions.
19414056 2009 Genetic polymorphism of interleukin-17A and -17F genes in gastric carcinogenesis.
19404732 2009 IL-17 stimulates migration of carotid artery vascular smooth muscle cells in an MMP-9 dependent manner via p38 MAPK and ERK1/2-dependent NF-kappaB and AP-1 activation.
19347604 2010 Increased serum interleukin 17 in patients with systemic lupus erythematosus.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19339380 2009 The IL-23/Th17 axis contributes to renal injury in experimental glomerulonephritis.
19333939 2009 Overexpression of interleukin-23, but not interleukin-17, as an immunologic signature of subclinical intestinal inflammation in ankylosing spondylitis.
19329213 2009 Increased intratumoral IL-17-producing cells correlate with poor survival in hepatocellular carcinoma patients.
19325128 2009 In vivo activated monocytes from the site of inflammation in humans specifically promote Th17 responses.
19322214 2009 The IL-23/Th17 axis in the immunopathogenesis of psoriasis.
19295614 2009 Th17 cytokines stimulate CCL20 expression in keratinocytes in vitro and in vivo: implications for psoriasis pathogenesis.
19273860 2009 Identification of IL-17-producing FOXP3+ regulatory T cells in humans.
19265168 2009 IL-17 induces monocyte migration in rheumatoid arthritis.
19265112 2009 Critical role for STAT3 in IL-17A-mediated CCL11 expression in human airway smooth muscle cells.
19260856 2009 Interleukin-17 increased progesterone secretion by JEG-3 human choriocarcinoma cells.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19255340 2009 Interleukin-17 and interferon-gamma are produced concomitantly by human coronary artery-infiltrating T cells and act synergistically on vascular smooth muscle cells.
19247658 2009 Expression of IL-23 and IL-17 and effect of IL-23 on IL-17 production in ankylosing spondylitis.
19244159 2009 Stage 3 immature human natural killer cells found in secondary lymphoid tissue constitutively and selectively express the TH 17 cytokine interleukin-22.
19242409 2009 IL-17 disrupts corneal barrier following desiccating stress.
19240794 2009 Sleep restriction increases the risk of developing cardiovascular diseases by augmenting proinflammatory responses through IL-17 and CRP.
19239321 2009 IL-17 family cytokines in neutrophils of patients with oral epithelial squamous cell carcinoma.
19235914 2009 Genetic epistasis of IL23/IL17 pathway genes in Crohn's disease.
19234216 2009 Anti-inflammatory role of IL-17 in experimental autoimmune uveitis.
19226302 2009 Serum interleukin-17 levels are related to clinical severity in allergic rhinitis.
19210369 2009 The polymorphisms of interleukin 17A (IL17A) gene and its association with pediatric asthma in Taiwanese population.
19208686 2009 Association analysis of the interleukin 17A gene in Caucasian rheumatoid arthritis patients from Norway and New Zealand.
19201028 2009 Synergism between tumor necrosis factor alpha and interleukin-17 to induce IL-23 p19 expression in fibroblast-like synoviocytes.
19199539 2009 IFN-gamma production during active tuberculosis is regulated by mechanisms that involve IL-17, SLAM, and CREB.
19187277 2009 The role of Th17 cells in adult patients with chronic idiopathic thrombocytopenic purpura.
19177575 2009 The interleukin-17 pathway is involved in human alcoholic liver disease.
19174010 2009 [Expression of interleukin-17 in hepatitis B related liver fibrosis].
19131064 2009 Interleukin 17: an unlikely marker of acute coronary syndrome?
19127457 2009 TH17 (and TH1) signatures of intestinal biopsies of CD patients in response to gliadin.
19124735 2009 Differential capability of human cutaneous dendritic cell subsets to initiate Th17 responses.
19079215 2008 Effective CD4+ T-cell restoration in gut-associated lymphoid tissue of HIV-infected patients is associated with enhanced Th17 cells and polyfunctional HIV-specific T-cell responses.
19075290 2008 Interleukin (IL)-1 promotes allogeneic T cell intimal infiltration and IL-17 production in a model of human artery rejection.
19056110 2009 IL-17 in atopic eczema: linking allergen-specific adaptive and microbial-triggered innate immune response.
19050297 2008 Expanded double negative T cells in patients with systemic lupus erythematosus produce IL-17 and infiltrate the kidneys.
19050268 2008 IL-17A enhances vitamin D3-induced expression of cathelicidin antimicrobial peptide in human keratinocytes.
19014637 2008 IL-17 expression by breast-cancer-associated macrophages: IL-17 promotes invasiveness of breast cancer cell lines.
18992745 2009 RORgamma-expressing Th17 cells induce murine chronic intestinal inflammation via redundant effects of IL-17A and IL-17F.
18941244 2008 Differential regulation of chemokines by IL-17 in colonic epithelial cells.
18941201 2008 IL-17-producing alveolar macrophages mediate allergic lung inflammation related to asthma.
18941172 2008 Cutting edge: IFN-gamma enables APC to promote memory Th17 and abate Th1 cell development.
18926293 2008 Interferon-alpha controls IL-17 expression in vitro and in vivo.
18832156 2008 Generation and regulation of human CD4+ IL-17-producing T cells in ovarian cancer.
18802458 2008 Interleukin-17A mediates acquired immunity to pneumococcal colonization.
18802076 2008 Induction of IL-17+ T cell trafficking and development by IFN-gamma: mechanism and pathological relevance in psoriasis.
18793860 2008 IL17 and IFNgamma production by peripheral blood mononuclear cells from clinically isolated syndrome to secondary progressive multiple sclerosis.
18786233 2008 The role of the IL23/IL17 axis in bronchiolitis obliterans syndrome after lung transplantation.
18769923 2008 Interleukin-17F gene polymorphisms in Korean patients with Behçet's disease.
18684981 2008 Identification of IL-18 and Th17 cells in salivary glands of patients with Sjögren's syndrome, and amplification of IL-17-mediated secretion of inflammatory cytokines from salivary gland cells by IL-18.
18684971 2008 The human IL-17F/IL-17A heterodimeric cytokine signals through the IL-17RA/IL-17RC receptor complex.
18669891 2008 Dendritic cells mediate the induction of polyfunctional human IL17-producing cells (Th17-1 cells) enriched in the bone marrow of patients with myeloma.
18663128 2008 Human interleukin 17-producing cells originate from a CD161+CD4+ T cell precursor.
18617638 2008 Human CD25highFoxp3pos regulatory T cells differentiate into IL-17-producing cells.
18615114 2008 Patients with chronic mucocutaneous candidiasis exhibit reduced production of Th17-associated cytokines IL-17 and IL-22.
18602680 2008 Serum IL-17 levels in patients with allergic rhinitis.
18600325 2008 Profile of Th17 cytokines (IL-17, TGF-beta, IL-6) and Th1 cytokine (IFN-gamma) in patients with immune thrombocytopenic purpura.
18591412 2008 Mutations in STAT3 and IL12RB1 impair the development of human IL-17-producing T cells.
<