Property Summary

Ligand Count 2
NCBI Gene PubMed Count 1,043
PubMed Score 4915.22
PubTator Score 2471.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
Plaque psoriasis 17
Disease Target Count P-value
psoriasis 6694 2.5e-79
ulcerative colitis 1819 2.5e-03

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 7.600 2.5e-79
ulcerative colitis 1.400 2.5e-03

 GO Function (1)

Protein-protein Interaction (5)

PDB (11)

Gene RIF (1028)

AA Sequence

MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRS      1 - 70
TSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILV     71 - 140
SVGCTCVTPIVHHVA                                                           141 - 155
//

Text Mined References (1046)

PMID Year Title