Property Summary

NCBI Gene PubMed Count 129
PubMed Score 423.98
PubTator Score 304.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
hepatocellular carcinoma 1.200 1.7e-04
psoriasis -1.800 1.3e-03
osteosarcoma -3.706 2.9e-12
periodontitis 1.100 5.5e-24
non-small cell lung cancer -1.069 3.9e-11
lung cancer -2.200 3.5e-05
interstitial cystitis 1.600 5.7e-03
primary Sjogren syndrome 1.400 4.6e-03
lung adenocarcinoma -1.200 2.4e-07
lung carcinoma -1.600 2.8e-33
ulcerative colitis 1.400 1.2e-03
ovarian cancer 1.100 1.4e-07

 GWAS Trait (1)

Protein-protein Interaction (4)

Gene RIF (118)

PMID Text
26842762 IL-16 rs1131445 C/T polymorphism is related to the susceptibility to cancer in Asians (meta-analysis)
26823871 the results of our study suggested an association between the IL-16 rs4778889 polymorphism and an elevated risk of renal cell carcinoma
26615570 We observed highly significant reductions in the concentration of circulating interleukin (IL)-16, IL-7, and Vascular Endothelial Growth Factor A (VEGF-A) in encephalomyelitis/chronic fatigue syndrome patients.
26386715 The IL16 rs4072111 polymorphism may be associated with susceptibility to AD and the T allele may have a protective role in the progression of AD in an Iranian population.
26154181 the lack of a relationship between genotype and serum levels of IL-16 seems to suggest a more complex regulation of this cytokine at the post-translational level and/or the interplay with other cytokines.
25954818 The results suggested that the variants in IL-16 gene rs11556218 site were associated with a decreased knee osteoarthritis risk after adjusting for age, sex, BMI, and smoking and drinking status.
25940130 intrathyroidal production of IL-14 and IL-16 associated with the pathogenesis of autoimmune thyroid disease
25710036 Based on these results, we believe that the increased levels of IL-12p40 and IL-16 are associated with an ongoing inflammatory response in obese individuals and could lead to the development of disease conditions related to obesity.
25166752 The findings suggest that the IL-16 rs 11556218 polymorphism may be used as a susceptibility marker for glioma.
25131111 There was no statistical significance between IL12B, IL16, and IL18 (rs187238) gene polymorphisms and kidney graft outcome after transplantation.
24969906 IL-16 rs11556218 T/G was associated with a significant increased risk of cancer.
24794807 Data suggest that thymic stromal lymphopoietin (TSLP) and interleukin-16 (IL-16), expressed at early stages of disease, function to recruit malignant T cells to the skin.
24736233 The production of IL-16 contributed to lung damage as neutralization of IL-16 enhanced S. aureus clearance and resulted in diminished lung pathology in S. aureus pneumonia.
24694201 The IL-16 SNP rs8028364 was found to be associated with Graves' disease(GD) when compared with the control subjects.
24568499 IL-16 rs4778889 T/C polymorphism is not associated with cancer.
24380743 This study showed that tissue expression and serum levels of IL-16 increase in association with malignant ovarian tumor development and progression.
24328527 The rs11556218 T/G polymorphism of the IL-16 gene was significantly associated with elevated cancer risk in Asian populations. [meta-analysis]
24320753 IL16 polymorphisms may play a role in the pathophysiology of alopecia areata or in the expression of phenotypes in Koreans.
24288444 the IL-16 polymorphism may be related to the etiology of ischemic stroke in the Chinese population
24200060 IL-16 plays an important role in the proliferation and apoptosis of MT-4 cells
24175812 Rs4778889 CC and rs11556218 GG genotype was significantly associated with 1.97 and 1.84-fold increased risk of non-cardia gastric cancer.
24138069 An association between decreased plasma IL-16 and emphysema susceptibility.
23894370 Interleukin-16 promotes cardiac fibrosis and myocardial stiffening in heart failure with preserved ejection fraction.
23881440 The IL-16 SNPs rs8034928 and rs11556218 are associated with the coronary artery disease risk in the Chinese population.
23252864 Levels of IL-16 and IFN-gamma in tuberculous pleural effusion group were significantly higher than that in malignant group.
23241166 study identified IL-16 as a critical tristetraprolin-regulated chemotactic factor that contributes to monocytes/macrophages migration
23020666 It is feasible to predict preterm birth by measuring the amniotic fluid levels of IL-16 especially for the pregnant women requiring genetic amniocentesis during early second trimester.
22939228 a significant relationship exists between the miRNA-binding site polymorphism of the IL-16 gene and colorectal cancer risk in the Iranian population
22923025 Authors identified three independent loci within IL16 that were associated with prostate cancer risk. SNP expression quantitative trait loci analyses revealed that rs7175701 is predicted to influence the expression of IL16 and other cancer-related genes.
22745469 IL-16 was strongly overexpressed in the bone marrow of myeloma patients compared with healthy donors. IL-16 is an important growth-promoting factor in multiple myeloma.
22019522 Data show that IL16 single nucleotide polymorphisms are associated with chronic hepatitis B virus infection and hepatocellular carcinoma.
21703255 IL-16 rs11556218 G/T polymorphism is significantly associated with the risk of coronary artery disease in the Chinese Han population.
21447961 Serum IL-16 levels of atopic dermatitis patients correlate to some extent with sensitization.
21267712 TcdA and TcdB downregulate IL-16 gene expression via inhibition of Rho GTPases.(TcdA and TcdB from C. difficile strain VPI 10463)
21214401 The TG/GG genotypes of rs11556218 T/G were associated with a significantly increased risk of coronary artery disease as compared with the TT genotype.
21094786 Stem cell factor, interleukin-16, and interleukin-2 receptor alpha are predictive biomarkers for delayed and slow graft function after deceased donor kidney transplantation.
21071540 Observational study of gene-disease association. (HuGE Navigator)
21036918 Tobacco smoke depletes preformed intracellular IL-16 protein, inhibits its de novo synthesis, and distorts key cellular functions in human CD8(+) cells.
20878214 Our results demonstrate that loss of intracellular IL-16 in peripheral blood T cells corresponds to lymphoma stage in Sezary Syndrome patients and orrelates with loss of surface CD26.
20811626 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20802378 Observational study of genetic testing. (HuGE Navigator)
20800603 Observational study of gene-disease association. (HuGE Navigator)
20662556 the rs4778889 T/C polymorphism of the IL-16 gene may be associated with risk of endometriosis
20662556 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20578037 Ability of IL-16 homolog from leech Hirudo medicinalis to recruit microglial cells to sites of nervous system injury suggests its in the crosstalk between neurons and microglia in the leech central nervous system repair.
20529140 IL-16 -295 T>C polymorphism is significantly associated with a higher risk of developing RCC in Chinese population.
20529140 Observational study of gene-disease association. (HuGE Navigator)
20503287 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20079227 The intensity of IL-16 and CXCR3 expression were correlated with the index of clinical and pulmonary function in COPD.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19789190 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19773451 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19758567 an association between IL-16 gene polymorphisms and the risk of nasopharyngeal carcinoma
19758567 Observational study of gene-disease association. (HuGE Navigator)
19476022 decreased levels following alpine mountain climate therapy in patients with allergic diseases and chronic obstructive pulmonary disease
19460752 Knockdown of interleukin 16 (IL16) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19298795 The IL-16 gene polymorphisms may be associated with the risk of systemic lupus erythematosus.
19298795 Observational study of gene-disease association. (HuGE Navigator)
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
19232499 Generation of bleomycin-induced lung fibrosis is independent of IL-16
19074885 Observational study of gene-disease association. (HuGE Navigator)
19073878 IL-16 polymorphisms may contribute to CRC and GC susceptibility.
19073878 Observational study of gene-disease association. (HuGE Navigator)
19066394 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18768901 IL-16 levels are significantly higher in severe preeclampsia (PE) than in mild PE and normal pregnant controls, indicating that increased IL-16 levels in PE are associated with the severity of the disease.
18676870 Observational study of gene-disease association. (HuGE Navigator)
18633131 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18446062 IL-17 and TLR2 ligands stimulate the production of IL-16 by rheumatoid arthritis fibroblast-like synoviocytes
18394967 IL-16 gene was significantly associated with susceptibility to Graves' disease and Graves' disease associated ophthalmopathy in the Chinese population.
18394967 Observational study of gene-disease association. (HuGE Navigator)
18264096 Susceptibility genes CPNE3, IL16 and CDH13 with moderate effects associated with susceptibility to prostate cancer.
18264096 Genome-wide association study of gene-disease association. (HuGE Navigator)
18097041 pro-IL-16 forms a complex with GABPbeta1 and HDAC3 in suppressing the transcription of Skp2.
17703412 Observational study of gene-disease association. (HuGE Navigator)
17577790 A possible prognostic role of IL-16 in lymphoid malignancies.
17576577 There was no evidence of a statistically significant association in the allelic distribution of IL4, IL10, IL16 and TNF polymorphism that were tested,nor in the haplotype frequencies in patietns with CD.
17551575 Increased levels of circulating IL-16 and apoptosis markers are related to the activity of Whipple's disease.
17537415 an elevation of serum IL16 appears in early trimester of pregnancy of women who later develop preeclampsia, suggesting IL16 plays a role in the pathogenesis of preeclampsia
17303923 Observational study of gene-disease association. (HuGE Navigator)
17303923 an influence of genetic variability at the promoter of IL-4 gene (-590C>T) and a coding region of IL-13 gene (R130Q) on the occurrence of allergic asthma and no relationship between IL-16 promoter polymorphism (-295T>C) and this disease.
17221335 IL-16 immunoreactivity is a putative marker of a monocytic subset in human gliomas in vivo and may be a novel factor in the regulation of the local inflammatory milieu and tumor progression.
16455991 determined the effects of IL-16 interaction with CD4 on CXCR3-induced migration
16447204 Observational study of gene-disease association. (HuGE Navigator)
16387589 Observational study of gene-disease association. (HuGE Navigator)
16375755 IL-16 induces rapid translocation of PKC from the cytosol to the membrane in CD4+ cells; PKC inhibitors completely block IL-16-induced lymphocyte migration as well as the motile response induced by HIV-1 gp120 and anti-CD4 antibody binding to CD4
16271292 Suggest that caspase-3 mediated production of IL-16 by infiltrating CD4+ T cells, contributes to ongoing neuroinflammation by chemoattraction of additional waves of CD4+ T cells in relapsing experimental autoimmune encephalomyelitis (EAE).
16178875 Observational study of gene-disease association. (HuGE Navigator)
16177102 IL-16, which is up-regulated in macrophages (Mphi), enables Tropheryma whipplei to replicate in monocytes and increases bacterial replication in Mphi; IL-16 down-modulates expression of thioredoxin and up-regulates that of IL-16 and proapoptotic genes
16144798 IL-16 activates a PI3K/inositol trisphosphate-dependent signaling pathway in mast cells; CD9 is essential for the IL-16-mediated chemotaxis and activation, acting as an IL-16 receptor in HMC-1, a mast cell line that lacks CD4
15886011 IL-12 and IL-16 may be related to the pathogenesis of periodontal disease, but within the periodontitis sites, IL-16 may be related to disease severity in alcohol drinkers/smokers
15820794 IL-16 in peritoneal fluid may play a role in the pathogenesis of endometriosis by initiating or sustaining inflammatory responses in the peritoneal cavity
15784111 Observational study of gene-disease association. (HuGE Navigator)
15682385 Treatment with neutralizing anti-IL-16 antibody successfully reversed paralysis and ameliorated relapsing experimental autoimmune encephalomyelitis (EAE). Relevance for the development of new therapies for relapsing EAE and potentially MS.
15619436 IL16 may play an important role in the development of alopecia areata
15560757 interleukin-16 production is impaired in monocyte-derived dendritic cells from atopic dermatitis patients but is restored by inflammatory cytokines TNF-alpha and IL-1beta
15383572 IL-16 is a potent promoter of eosinophil migration through the extracellular matrix components, an effect that is initiated via CD4 and mediated via the release of CCR3 ligand chemokines.
15342983 Increased IL-16 levels are associated with hemophagocytic lymphohistiocytosis
15253385 interleukin-16 and its precursor have roles in T lymphocyte activation and growth [review]
15187155 IL-16 is constitutively present in peripheral blood monocytes; spontaneous caspase-3 activation (apoptosis) was paralleled by the loss of intracellular IL-16; stimulation with LPS inhibited caspase-3 activation and inhibited the release of IL-16.
15175077 recruitment of IL-16+ T cells and microglia/macrophages may represent an innate response to HIV-1 infection in the central nervous system that counterbalances viral stimulatory factors
14755377 Patients with a high level of IL-16 (>430 pg/ml) in multiple myeloma displayed an inferior survival time in comparison to those with lower levels of IL-16.
14734747 Nuclear IL-16 precursor is identified as a novel regulator of S-phase kinase-associated protein-2 (Skp2) expression and cyclin-dependent kinase inhibitor 1B (p27KIP1) levels, with a role in T cell proliferation.
14705216 the cytokine IL-16 plays a role in the disease process underlying rheumatoid arthritis and joint destruction.
14657881 Observational study of gene-disease association. (HuGE Navigator)
14657881 IL16 genotype was overrepresented among polysensitized individuals (7.0% vs 1.0% in the control group; odds ratio, 7.68; 95% CI, 1.59-48.12) with allergic contact dermatitis to para-substituted aryl compounds
12923170 identified three closely related myosin phosphatase targeting subunits, MYPT1, MYPT2, and MBS85, as binding partners of the IL-16 precursor proteins
12620798 binds to Tax in HTLV-1 infected T cells
12450396 The bipartite nuclear localization sequence (NLS) of pro-IL-16 is part of a dual phosphorylation-regulated CcN motif consisting of a protein kinase CK2 substrate site, a cdc2 kinase substrate site, and an NLS.
12191564 serum level of (IL)-16 was significantly higher in stage III multiple myeloma patients than in healthy controls. The decrease of CD4(+) T cells in MM may be mediated by activation of CD8(+) T cells derived cytokine IL-16.
11999883 Elevated IL-16 levels in patients with systemic lupus erythematosus are associated with disease severity but not with genetic susceptibility to lupus.
11937573 IL-16 enhances c-kit ligand-mediated expression of tryptase and chymase in mast cells and basophils developed from cord blood and peripheral blood progenitors, is a chemotactic factor for these cells, and inhibits their vulnerability to HIV-1 infection.
11714796 IL-16 released from epidermal Langerhans cells after allergen-mediated activation through Fc epsilon RI may link IgE-driven and cellular inflammatory responses in diseases such as atopic dermatitis.
8977168 IL-16 induces rapid translocation of PKC from the cytosol to the membrane in CD4+ cells; PKC inhibitors completely block IL-16-induced lymphocyte migration as well as the motile response induced by HIV-1 gp120 and anti-CD4 antibody binding to CD4
8599832 IL-16 induces rapid translocation of PKC from the cytosol to the membrane in CD4+ cells; PKC inhibitors completely block IL-16-induced lymphocyte migration as well as the motile response induced by HIV-1 gp120 and anti-CD4 antibody binding to CD4
6729885 Correlations between increased levels of secreted IL-16, CD4+ Th1 cell inflammation, and phosphorylation of axonal cytoskeleton in Multiple sclerosis (MS) lesions. Possible role for IL-16 in regulation of inflammation and axonal cytoskeleton in MS.

AA Sequence

MESHSRAGKSRKSAKFRSISRSLMLCNAKTSDDGSSPDEKYPDPFEISLAQGKEGIFHSSVQLADTSEAG      1 - 70
PSSVPDLALASEAAQLQAAGNDRGKTCRRIFFMKESSTASSREKPGKLEAQSSNFLFPKACHQRARSNST     71 - 140
SVNPYCTREIDFPMTKKSAAPTDRQPYSLCSNRKSLSQQLDCPAGKAAGTSRPTRSLSTAQLVQPSGGLQ    141 - 210
ASVISNIVLMKGQAKGLGFSIVGGKDSIYGPIGIYVKTIFAGGAAAADGRLQEGDEILELNGESMAGLTH    211 - 280
QDALQKFKQAKKGLLTLTVRTRLTAPPSLCSHLSPPLCRSLSSSTCITKDSSSFALESPSAPISTAKPNY    281 - 350
RIMVEVSLQKEAGVGLGIGLCSVPYFQCISGIFVHTLSPGSVAHLDGRLRCGDEIVEISDSPVHCLTLNE    351 - 420
VYTILSHCDPGPVPIIVSRHPDPQVSEQQLKEAVAQAVENTKFGKERHQWSLEGVKRLESSWHGRPTLEK    421 - 490
EREKNSAPPHRRAQKVMIRSSSDSSYMSGSPGGSPGSGSAEKPSSDVDISTHSPSLPLAREPVVLSIASS    491 - 560
RLPQESPPLPESRDSHPPLRLKKSFEILVRKPMSSKPKPPPRKYFKSDSDPQKSLEERENSSCSSGHTPP    561 - 630
TCGQEARELLPLLLPQEDTAGRSPSASAGCPGPGIGPQTKSSTEGEPGWRRASPVTQTSPIKHPLLKRQA    631 - 700
RMDYSFDTTAEDPWVRISDCIKNLFSPIMSENHGHMPLQPNASLNEEEGTQGHPDGTPPKLDTANGTPKV    701 - 770
YKSADSSTVKKGPPVAPKPAWFRQSLKGLRNRASDPRGLPDPALSTQPAPASREHLGSHIRASSSSSSIR    771 - 840
QRISSFETFGSSQLPDKGAQRLSLQPSSGEAAKPLGKHEEGRFSGLLGRGAAPTLVPQQPEQVLSSGSPA    841 - 910
ASEARDPGVSESPPPGRQPNQKTLPPGPDPLLRLLSTQAEESQGPVLKMPSQRARSFPLTRSQSCETKLL    911 - 980
DEKTSKLYSISSQVSSAVMKSLLCLPSSISCAQTPCIPKEGASPTSSSNEDSAANGSAETSALDTGFSLN    981 - 1050
LSELREYTEGLTEAKEDDDGDHSSLQSGQSVISLLSSEELKKLIEEVKVLDEATLKQLDGIHVTILHKEE   1051 - 1120
GAGLGFSLAGGADLENKVITVHRVFPNGLASQEGTIQKGNEVLSINGKSLKGTTHHDALAILRQAREPRQ   1121 - 1190
AVIVTRKLTPEAMPDLNSSTDSAASASAASDVSVESTAEATVCTVTLEKMSAGLGFSLEGGKGSLHGDKP   1191 - 1260
LTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKALPDGPVTIVIRRKSLQSKETTAAG   1261 - 1330
DS                                                                       1331 - 1332
//

Text Mined References (134)

PMID Year Title
26842762 2016 Positive association between IL-16 rs1131445 polymorphism and cancer risk: a meta-analysis.
26823871 2015 Interleukin-16 rs4778889 polymorphism contributes to the development of renal cell cancer in a Chinese population.
26615570 2016 Reductions in circulating levels of IL-16, IL-7 and VEGF-A in myalgic encephalomyelitis/chronic fatigue syndrome.
26386715 2015 Association between polymorphisms in Interleukin-16 gene and risk of late-onset Alzheimer's disease.
26154181 2015 -295 T-to-C promoter region IL-16 gene polymorphism is associated with Whipple's disease.
25954818 2015 Genetic polymorphisms of interleukin-16 and risk of knee osteoarthritis.
25940130 2015 IL-14 and IL-16 are expressed in the thyroid of patients with either Graves' disease or Hashimoto's thyroiditis.
25710036 2015 Elevated plasma levels of interleukin-12p40 and interleukin-16 in overweight adolescents.
25166752 2014 Interleukin-16 polymorphism is associated with an increased risk of glioma.
25131111 The impact of interleukin 12B (1188A>C), interleukin 16 (-295T>C), and interleukin 18 (607C>A, 137G>C) gene polymorphisms on long-term renal transplant function and recipient outcomes.
24969906 2014 Positive association between IL-16 rs11556218 T/G polymorphism and cancer risk: a meta-analysis.
24794807 2015 CCR4+T cell recruitment to the skin in mycosis fungoides: potential contributions by thymic stromal lymphopoietin and interleukin-16.
24736233 2014 Secretion of IL-16 through TNFR1 and calpain-caspase signaling contributes to MRSA pneumonia.
24694201 2014 Association of interleukin-16 polymorphisms with graves' disease in a Taiwanese population.
24568499 2014 Non-association of IL-16 rs4778889 T/C polymorphism with cancer risk in Asians: a meta-analysis.
24380743 2014 Interleukin 16 expression changes in association with ovarian malignant transformation.
24328527 2014 Interleukin-16 gene polymorphisms rs4778889, rs4072111, rs11556218, and cancer risk in Asian populations: a meta-analysis.
24320753 2014 Association between IL16 gene polymorphisms and susceptibility to alopecia areata in the Korean population.
24288444 2013 Interleukin-16 polymorphism is associated with an increased risk of ischemic stroke.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24200060 2013 [Recombinant human IL-16 inhibits proliferation and induces apoptosis in MT-4 cells].
24175812 2013 Variants of interleukin-16 associated with gastric cancer risk.
24138069 2013 Integrative omics approach identifies interleukin-16 as a biomarker of emphysema.
23894370 2013 Interleukin-16 promotes cardiac fibrosis and myocardial stiffening in heart failure with preserved ejection fraction.
23881440 2013 Association between interleukin 6 and interleukin 16 gene polymorphisms and coronary heart disease risk in a Chinese population.
23252864 2013 Crucial role of CD4+CD 25+ FOXP3+ T regulatory cell, interferon-? and interleukin-16 in malignant and tuberculous pleural effusions.
23241166 2013 Depletion of tristetraprolin in breast cancer cells increases interleukin-16 expression and promotes tumor infiltration with monocytes/macrophages.
23020666 2013 High interleukin-16 concentrations in the early second trimester amniotic fluid: an independent predictive marker for preterm birth.
22939228 2012 Association of polymorphisms in microRNA-binding sites and colorectal cancer in an Iranian population.
22923025 2012 Fine-mapping of IL16 gene and prostate cancer risk in African Americans.
22745469 2012 Role of interleukin 16 in multiple myeloma.
22019522 2011 Genetic polymorphism of interleukin-16 influences susceptibility to HBV-related hepatocellular carcinoma in a Chinese population.
21703255 2011 IL-16 rs11556218 gene polymorphism is associated with coronary artery disease in the Chinese Han population.
21447961 2011 Association between serum IL-16 levels and the degree of sensitization in patients with atopic dermatitis.
21269460 2011 Initial characterization of the human central proteome.
21267712 2011 Down-regulation of interleukin-16 in human mast cells HMC-1 by Clostridium difficile toxins A and B.
21214401 2011 Association between interleukin-16 polymorphisms and risk of coronary artery disease.
21094786 2010 Stem cell factor, interleukin-16, and interleukin-2 receptor alpha are predictive biomarkers for delayed and slow graft function.
21071540 2011 Validation of genome-wide prostate cancer associations in men of African descent.
21036918 2011 Effects of tobacco smoke on IL-16 in CD8+ cells from human airways and blood: a key role for oxygen free radicals?
20878214 2011 Interleukin-16 as a marker of Sézary syndrome onset and stage.
20811626 2010 Genetic variants in inflammation-related genes are associated with radiation-induced toxicity following treatment for non-small cell lung cancer.
20802378 2010 A multiplex MALDI-TOF MS approach facilitates genotyping of DNA from formalin-fixed paraffin-embedded tumour specimens.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20662556 2010 Association of an interleukin-16 gene polymorphism with the risk and pain phenotype of endometriosis.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20578037 2010 A homologous form of human interleukin 16 is implicated in microglia recruitment following nervous system injury in leech Hirudo medicinalis.
20529140 2010 IL-16 polymorphism and risk of renal cell carcinoma: association in a Chinese population.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20079227 2009 [The changes and significance of interleukin-16 and CXC chemokine receptor 3 expression in pulmonary artery of smokers with chronic obstructive pulmonary disease].
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19906316 2009 Discovery of novel human transcript variants by analysis of intronic single-block EST with polyadenylation site.
19789190 2009 A gene-based risk score for lung cancer susceptibility in smokers and ex-smokers.
19773451 2009 Role of inflammation gene polymorphisms on pain severity in lung cancer patients.
19758567 2009 Genetic polymorphism of interleukin-16 and risk of nasopharyngeal carcinoma.
19476022 2009 Benefits of alpine mountain climate of Bavaria in patients with allergic diseases and chronic obstructive pulmonary disease: results from the AURA* study.
19298795 2009 The IL-16 gene polymorphisms and the risk of the systemic lupus erythematosus.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19232499 2009 Generation of bleomycin-induced lung fibrosis is independent of IL-16.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19073878 2009 The association of interleukin-16 polymorphisms with IL-16 serum levels and risk of colorectal and gastric cancer.
19066394 2009 Organochlorine exposure, immune gene variation, and risk of non-Hodgkin lymphoma.
18821565 2008 Genome-wide association scan of quantitative traits for attention deficit hyperactivity disorder identifies novel associations and confirms candidate gene associations.
18768901 2008 Elevated maternal IL-16 levels, enhanced IL-16 expressions in endothelium and leukocytes, and increased IL-16 production by placental trophoblasts in women with preeclampsia.
18676870 2008 Variants in inflammation genes and the risk of biliary tract cancers and stones: a population-based study in China.
18633131 2008 Host immune gene polymorphisms in combination with clinical and demographic factors predict late survival in diffuse large B-cell lymphoma patients in the pre-rituximab era.
18446062 2008 IL-17 induces the production of IL-16 in rheumatoid arthritis.
18394967 2008 Association of the interleukin (IL)-16 gene polymorphisms with Graves' disease.
18264096 2008 Multiple loci identified in a genome-wide association study of prostate cancer.
18097041 2008 Pro-IL-16 recruits histone deacetylase 3 to the Skp2 core promoter through interaction with transcription factor GABP.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18006695 2008 Scan of 977 nonsynonymous SNPs in CLL4 trial patients for the identification of genetic variants influencing prognosis.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17577790 2007 Serum levels of interleukin-16 in lymphoid malignancies.
17576577 2008 IL4, IL10, IL16, and TNF polymorphisms in New Zealand Caucasian Crohn's disease patients.
17551575 2007 Increased levels of circulating IL-16 and apoptosis markers are related to the activity of Whipple's disease.
17537415 2007 Serum IL-16, not IL-15, was elevated in early second trimester of pregnancy in women who subsequently developed preeclampsia.
17303923 2007 Association between the polymorphisms of IL-4 gene promoter (-590C>T), IL-13 coding region (R130Q) and IL-16 gene promoter (-295T>C) and allergic asthma.
17221335 Expression of interleukin-16 by tumor-associated macrophages/activated microglia in high-grade astrocytic brain tumors.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16455991 2006 Chemokine receptor CXCR3 desensitization by IL-16/CD4 signaling is dependent on CCR5 and intact membrane cholesterol.
16447204 2006 Allograft TNFbeta and IL16 polymorphisms influence HCV recurrence and severity after liver transplantation.
16387589 2006 Association of asthma with a functional promoter polymorphism in the IL16 gene.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16271292 2005 Increased levels of bioactive IL-16 correlate with disease activity during relapsing experimental autoimmune encephalomyelitis (EAE).
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16178875 2005 Prevalence of the -295 T-to-C promoter polymorphism of the interleukin (IL)-16 gene in periodontitis.
16177102 2005 IL-16 is critical for Tropheryma whipplei replication in Whipple's disease.
16144798 2006 Human and mouse mast cells use the tetraspanin CD9 as an alternate interleukin-16 receptor.
15886011 2005 Interleukin-12 and interleukin-16 in periodontal disease.
15820794 2005 Elevated interleukin-16 levels in the peritoneal fluid of women with endometriosis may be a mechanism for inflammatory reactions associated with endometriosis.
15784111 2005 A polymorphism in the promoter region of the human interleukin-16 gene is not associated with asthma or atopy in an Australian population.
15682385 2005 Anti-IL-16 therapy reduces CD4+ T-cell infiltration and improves paralysis and histopathology of relapsing EAE.
15619436 2005 Interleukin-16 in patients with alopecia areata.
15560757 2004 The maturation-dependent production of interleukin-16 is impaired in monocyte-derived dendritic cells from atopic dermatitis patients but is restored by inflammatory cytokines TNF-alpha and IL-1beta.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15383572 2004 IL-16 activates plasminogen-plasmin system and promotes human eosinophil migration into extracellular matrix via CCR3-chemokine-mediated signaling and by modulating CD4 eosinophil expression.
15342983 2004 Increased IL-16 levels in hemophagocytic lymphohistiocytosis.
15253385 2004 The effect of interleukin-16 and its precursor on T lymphocyte activation and growth.
15187155 2004 IL-16 is constitutively present in peripheral blood monocytes and spontaneously released during apoptosis.
15175077 2004 IL-16 expression in lymphocytes and microglia in HIV-1 encephalitis.
14755377 2004 Serum level of interleukin-16 in multiple myeloma patients and its relationship to disease activity.
14734747 2004 Nuclear pro-IL-16 regulation of T cell proliferation: p27(KIP1)-dependent G0/G1 arrest mediated by inhibition of Skp2 transcription.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
14705216 2004 Enhanced concentrations of interleukin 16 are associated with joint destruction in patients with rheumatoid arthritis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14657881 2003 Association of allergic contact dermatitis with a promoter polymorphism in the IL16 gene.
12923170 2003 PDZ Domain-mediated interaction of interleukin-16 precursor proteins with myosin phosphatase targeting subunits.
12620798 2003 Binding of HTLV-1 tax oncoprotein to the precursor of interleukin-16, a T cell PDZ domain-containing protein.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12450396 2002 Prointerleukin-16 contains a functional CcN motif that regulates nuclear localization.
12191564 2002 Relationship between CD4(+)/CD8(+) T cell ratio and T cell activation in multiple myeloma: reference to IL-16.
11999883 2002 Elevated IL-16 levels in patients with systemic lupus erythematosus are associated with disease severity but not with genetic susceptibility to lupus.
11276202 2001 Gene regulation mediated by calcium signals in T lymphocytes.
11032842 2001 Nuclear translocation of the N-terminal prodomain of interleukin-16.
10479680 1999 Neuronal interleukin-16 (NIL-16): a dual function PDZ domain protein.
10477592 1999 A role for IL-16 in the cross-talk between dendritic cells and T cells.
10438516 1999 Identification of a CD4 domain required for interleukin-16 binding and lymphocyte activation.
10343113 1999 Assignment of human interleukin 16 (IL16) to chromosome 15q26.3 by radiation hybrid mapping.
9990060 1999 GA-binding protein factors, in concert with the coactivator CREB binding protein/p300, control the induction of the interleukin 16 promoter in T lymphocytes.
9743378 1998 Tissue and T cell distribution of precursor and mature IL-16.
9699630 1998 Structure of interleukin 16 resembles a PDZ domain with an occluded peptide binding site.
9422780 1998 Processing and activation of pro-interleukin-16 by caspase-3.
9271307 1997 Increased expression of interleukin-16 in bronchial mucosa of subjects with atopic asthma.
9144227 1997 Molecular cloning, sequence, expression, and processing of the interleukin 16 precursor.
8977168 1997 IL-16 represses HIV-1 promoter activity.
8609984 1996 Interleukin-16 or not?
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7910967 1994 Molecular and functional analysis of a lymphocyte chemoattractant factor: association of biologic function with CD4 expression.
7615501 1995 The CD4-associated tyrosine kinase p56lck is required for lymphocyte chemoattractant factor-induced T lymphocyte migration.
6729885 Autoradiographic determination of brain pH following middle cerebral artery occlusion in the rat.
1851800 1991 CD4-mediated stimulation of human eosinophils: lymphocyte chemoattractant factor and other CD4-binding ligands elicit eosinophil migration.