Property Summary

NCBI Gene PubMed Count 89
PubMed Score 14.97
PubTator Score 88.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
cutaneous lupus erythematosus 1.200 9.6e-04
interstitial cystitis 1.500 6.6e-04
lung cancer -1.600 4.5e-04
malignant mesothelioma 2.700 5.1e-08
osteosarcoma -1.805 1.8e-07
ulcerative colitis 1.200 1.3e-08

Protein-protein Interaction (1)

Gene RIF (76)

AA Sequence

MAPRRARGCRTLGLPALLLLLLLRPPATRGITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTS      1 - 70
SLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTA     71 - 140
ATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTTVAIST    141 - 210
STVLLCGLSAVSLLACYLKSRQTPPLASVEMEAMEALPVTWGTSSRDEDLENCSHHL                 211 - 267
//

Text Mined References (92)

PMID Year Title