Property Summary

NCBI Gene PubMed Count 353
PubMed Score 1248.23
PubTator Score 1041.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
Multiple myeloma 1.109 2.8e-02
urothelial carcinoma -1.100 1.6e-02
malignant mesothelioma -1.900 6.1e-08
cutaneous lupus erythematosus 1.400 3.2e-03
osteosarcoma -1.710 9.0e-03
glioblastoma 1.100 9.2e-03
tuberculosis 1.100 1.2e-04
non-small cell lung cancer -1.192 5.0e-08
intraductal papillary-mucinous neoplasm ... 1.200 4.5e-02
colon cancer -2.100 4.3e-02
lung cancer -2.700 5.7e-05
active Crohn's disease 1.406 3.2e-02
active ulcerative colitis 1.165 3.5e-02
sarcoidosis 1.200 2.1e-02
Breast cancer -3.300 2.5e-02
adult high grade glioma 1.300 6.3e-03
pilocytic astrocytoma 1.300 1.6e-06
posterior fossa group A ependymoma 1.200 2.6e-04
nasopharyngeal carcinoma 1.300 2.8e-03
ovarian cancer -2.500 1.6e-07

 GO Function (1)

 IMPC Phenotype (1)

Protein-protein Interaction (2)

Gene RIF (343)

PMID Text
27129235 Culturing NK cells under hypoxia compared with ambient air (normoxia) and IL-15 priming synergistically augmented glycolytic gene expression without major changes in glycolytic flux and glucose consumption.
27097762 Virtual memory T cells develop and mediate bystander protective immunity in an IL-15-dependent manner.
26719339 The novel mechanism of IL-15 transfer to the surface of antigen-processing DCs may explain the enhanced potency of IL-15:IL-15Ralpha-coated nanoparticles for antigen delivery.
26675759 Report improved antitumoral NK-cell activity in DC-based vaccine strategies through the use of IL-15/IL-15Ralpha mRNA-engineered designer DC.
26625316 Findings suggest for co-targeting shedding-derived soluble MIC (sMIC) to enhance the therapeutic efficacy of ALT-803 or other interleukin 15 (IL-15) agonists.
26567920 Studeis indicate that expression of interleukin-15 (IL-15) in tissues promotes T helper 1 cell-mediated immunity.
26481260 results demonstrated the relative functional deficiencies of alpha-GalCer induced UCB iNKT cells, which can be ameliorated by IL-15
26479922 IL15 was expressed primarily in the suprabulb of the hair follicle.
26464654 Protein, mRNA, and serum expression levels of MMP-7 and IL-15 in patients with osteoarthritis were all significantly increased in osteoarthritis patients compared with the control group.
26453750 These findings demonstrate a novel mechanism to attenuate IL-15-dependent NK cell proliferation and suggest that inhibitory NK cell receptors contribute to NK cell homeostasis.
26255115 Downregulation of STAT3 phosphorylation enhances tumoricidal effect of IL-15-activated dendritic cell against doxorubicin-resistant lymphoma and leukemia via TNF-alpha.
26241055 data reveal that inflammatory IL-15 promotes optimal responses by memory CD8+ T cells.
26141233 IL-15 induces strong but short-lived tumor-infiltrating CD8 T cell responses through the regulation of Tim-3 in breast cancer.
26136429 These findings, together with immunohistochemical evidence of apoptotic cells and IL-15-producing cells proximal to B cell chronic lymphocytic leukemia (B-CLL) pseudofollicles in patient spleens, suggest that collaborative ODN and IL-15 signaling may promote in vivo B-CLL growth.
26085358 Common gamma-chain cytokines IL-2, IL-7, and IL-15 prevent differentiation of naive T cells in vitro and limit activation of primed T cells in the absence of antigenic stimulus, which can contribute to the formation of cytokine imbalance.
26046663 IL-15 dependent induction of IL-18 secretion as a feedback mechanism controlling human MAIT-cell effector functions
26025664 Our study provides a better understanding of IL-15 signaling in renal cell carcinoma tumor progression
25964490 IRF-1 promotes LTx I/R injury via hepatocyte IL-15/IL-15Ralpha production and suggest that targeting IRF-1 and IL-15/IL-15Ralpha may be effective in reducing I/R injury associated with LTx.
25907558 Stress-activated Dendritic Cells (DC) Induce Dual Interleukin (IL)-15- and IL1beta-mediated Pathways, Which May Elicit CD4+ Memory T Cells and Interferon (IFN)-stimulated Genes.
25902870 Exercise-stimulated interleukin-15 is controlled by AMPK and regulates skin metabolism and aging.
25879761 Report Il15 levels in synovial fluid from rheumatoid arthritis patients.
25736261 IL15 is dedicated to the prolonged maintenance of memory T-cell responses to invading pathogens. [review]
25627006 In this study, our results showed that, in the nude mouse animal models, IL-15-expressing oncolytic virus had a stronger antitumor effect than oncolytic virus that did not express IL-15
25617471 Increased peripheral and local levels of IL-15 amplify the pathogenic potential of CD4+CD282 T cells, thus contributing to tissue damage in multiple sclerosis brain lesions.
25582338 IL-15-derived dendritic cells elicited greater antigen-specific, primary and secondary CD8 and CD4 T-cell responses than did IL-4-derived ones
25577895 NK cell activity in children with IDDM after in vitro stimulation by IL15 inhibits autoimmunity by increased IL10 synthesis.
25486870 IL-15 has a role in growth and survival signaling in Hodgkin lymphoma and enhances the inflammatory phenotype of HRS cells
25481744 Our results identify core mechanisms dictating human tTreg development, with IL-2 and IL-15 defining specific niches required for tTreg lineage stabilization and differentiation, with implications for their therapeutic targeting in autoimmune conditions.
25428383 Our data suggest that serum IL-15 at diagnosis is a novel, powerful predictor of prognosis for extranodal NK/T cell lymphoma
25412359 Hantavirus-infected cells were shown to strongly activate NK cells in a cell-cell contact-dependent way, and this response was blocked with anti-IL-15 antibodies.
25080789 The detection of basal level of IgM rheumatoid factor, IgM and also certain cytokines can be useful in prognosis of effectiveness of rituximab therapy under rheumatoid arthritis.
25080481 Enhanced T cell activation following combination targeting depended on DC-mediated cytokine release and was IL-15 dependent.
25006133 Data indicate that natural killer (NK) cell expressing mbIL15 (linked IL15 gene to that encoding CD8alpha transmembrane domain) had higher cytotoxicity against leukemia, lymphoma, and solid tumor cells in vitro and in xenograft models.
24999042 Unactivated memory CD4+ T cells infected by HIV-1 in the presence of IL-2 and IL-15 alone or IL-6/IL-7/TNF-alpha combination, upregulate granzyme B and HIV-1 CA production
24953855 role in progression of bladder cancer
24912180 Data suggest that the Interleukin (IL)-15 and interleukin 15 receptor alpha (IL-15.IL-15Ralpha) complex cleaved from presenting cells allows responding cells to internalize, store and use IL-15.IL-15Ralpha complex for their own proliferation and survival.
24805144 we have identified IL-15 receptors on the surface of cardiomyocytes and delineated the signaling system by which hypoxic cardiomyocytes may be protected from cellular death and rescued from oxidative stress with IL-15 treatment
24795032 In addition to implicating IL15 deletion as a potential mechanism of immune escape in colorectal cancer, findings suggest that IL15 deletion may have utility as a prognostic biomarker in colorectal cancer.
24777763 DC-produced IL-15 to achieve the anti-HIV-1 specific priming.
24762213 Data indicate an association between interleukin-15 (IL-15) rs3806798 and the risk of chronic HBV infection in Chinese Han population.
24748538 These results show that IL-15 and IL-12 combination has the ability to expand the selective depletion of invariant natural killer T cells in vitro in HIV-infected individuals.
24737791 Studies indicate that IL-15 signaling pathway aberrancies in its regulation are associated with chronic inflammation and cancer.
24721706 Data show that interleukin 15 (hIL-15) gene-modified NK cells can augment the anti-tumor effect of NK cells on hepatocellular carcinoma (HCC) in vivo and suggest applicability as a new candidate for adoptive immunotherapy against HCCs in the future.
24700781 Il-15 increases pre-B acute lymphoblastic leukemia growth and upregulates central nervous system homing molecules, and MEK/ERK, PI3K, and NF-kappaB inhibitors block IL-15 growth effects.
24689757 our results show an association between both rs10519612 and rs17007695 polymorphisms and the risk of developing ALL, but there was no impact on OS or DFS in these patients.
24670802 This study suggests that BAFF suppresses IL-15 expression in autoimmune diseases
24666229 Data suggest that IL-4, IL-15, and VEGF, may play roles in the pathogenesis of myasthenia gravis (MG).
24657713 monocytes of healthy older adults (age >/= 65) had increased cell surface IL-15 expression in response to IFN-gamma compared to those of healthy young adults (age </= 40).
24621498 IL-15 and IL-17F are differentially regulated and expressed in MF. We propose that IL-15 and IL-17F are markers for different inflammatory environments and play distinct roles in the development and progression of MF.
24603895 Circulating levels of IL-15 and IL-15Ralpha seem to reflect visceral distribution of adipose tissue; epicardial fat may be a potential source of both IL-15 and IL-15Ralpha.
24489097 The effects of IL-2/IL-15 depended on MAPK/ERK signaling and induced de novo expression of the transcription factors T-bet and eomesodermin, as well as the cytolytic enzyme perforin, required for the cytotoxic type 1 program.
24415300 IL-15 rs2254514 polymorphism might have an important role in the development of UC in the Mexican population.
24394601 IL15 RNA expression did not vary in duodenal samples of celiac disease patients and controls.
24361466 In mice given food antigen, cooperation between IL15 and CD4(+) T cells is necessary and sufficient to activate CD8(+) T cells and damage the small intestine.
24347177 The expression of vascular endothelial growth factor (VEGF), matrix metalloproteinase 2 (MMP2), tissue inhibitor of metalloproteinase 1 (TIMP1), interleukin 6 (IL-6), and interleukin 15 (IL-15).
24274595 The association of single nucleotide polymorphisms in IL1B, IL1RN and IL15 with chronic cavitary pulmonary aspergillosis supports a role for the IL1 pathway, as well as implicating the IL15 gene, in disease susceptibility.
24198185 Hence, the targeted combination of IL-15 and 4-BBL in the form of a trifunctional antibody-fusion protein is a promising new approach for cancer immunotherapy.
24184554 dispensable for maintenance of circulating NK cells
24086722 Interleukin 15 primes natural killer cells to kill via NKG2D and cPLA2 and this pathway is active in psoriatic arthritis.
24049167 Unactivated memory CD4+ T cells infected by HIV-1 in the presence of IL-2 and IL-15 alone or IL-6/IL-7/TNF-alpha combination, upregulate granzyme B and HIV-1 CA production
23996684 Single nucleotide polymorphism in IL15 gene is associated with ER-positive breast cancers only in American women of African ancestry.
23950892 Data indicate that tumor necrosis factor-alpha (TNF) abolishes nuclear localization of IL-15 and IL-15Ralpha by acting on chromosomal region maintenance 1 (CRM1), and it facilitates exocytosis of IL-15 with the involvement of ADP-ribosylation factor 6 (ARF6).
23904514 Premature action of IL-15 interferes with CD62L-dependent tethering/rolling of peripheral blood CD16(-) NK cells on Human uterine microvascular endothelial cells, which is an early critical process of leukocyte extravasation.
23904478 Disordered IL-15 and IL-15Ralpha may be involved in type 1 diabetes (T1D) and the IL-15/IL15Ralpha system and its signaling pathway may be rational therapeutic targets for early T1D.
23873932 Sp1 is required for IL-15 induction by both poly(I:C) and respiratory syncytial virus, a response that also requires NFkappaB2 and IKKepsilon.
23791986 although IL-15 seems to be responsible for inflammation and autoimmunity, it also may increase the immune response against cancer. [review]
23773307 we present an association of IL-15 gene polymorphisms with the RFs including subtypes (RF, IgG, IgA) underlined by the relation of increased IL-15 levels in circulation to RFs.
23700042 IL-15 is upregulated in uterosacral ligaments in pelvic organ prolapse
23649772 Various alleles, haplotypes and genotypes are found at higher frequencies in visceral leishmaniasis ptients, whereas others are more frequent in controls.
23649624 Data show efficient production of noncovalently linked but stable heterodimer in clonal HEK293 cells and release of the processed IL-15.sIL-15Ralpha heterodimer in the medium.
23637340 expression of IL-15 in the tumor microenvironment may prevent the escape of antigen loss variants and subsequent tumor recurrence
23577098 decreased level of cytokines in smokers with CT detected emphysema
23437070 IL-7 and IL-15 levels remain relatively low after nonmyeloablative transplantation.
23417200 there was no difference in serum IL-15 levels between active and inactive disease states in Behcet disease.
23401701 a promising marker differentiating an missed abortion from an ectopic pregnancy
23325887 IL-15 or IL-7 priming of the RasGRP/SOS pathway contributes to the increased ERK responsiveness and reduces the threshold above which signaling cascades are initiated, thereby predisposing for autoimmunity.
23214303 IL-15 in the amniotic fluid is significantly higher in the third trimester of pregnancy than in the second trimester.
23214284 Il-15 levels were not significantly different the amniotic fluid of fetuses with normal karyotypes and with chromosome abnormalities.
23160470 IL-7 and IL-15 instruct the generation of human memory stem T cells from naive precursors.
23157547 Detailed mechanistic knowledge of IL-15 biology is envisaged to make the most of a powerful immunotherapeutic tool ranked as one of the most promising for cancer immunotherapy.
23153537 IL-15 represses miR-29b via induction of Myc/NF-kappaBp65/Hdac-1, resulting in Dnmt3b overexpression and DNA hypermethylation.
23104097 study found in the structure of the IL-15-IL-15Ralpha-IL-2Rbeta-gamma(c) quaternary complex, IL-15 binds to IL-2Rbeta and gamma(c) in a heterodimer nearly indistinguishable from the IL-2-IL-2Ralpha-IL-2Rbeta-gamma(c) complex, despite their different receptor-binding chemistries; IL-15 and IL-2 induced similar signals
23074221 Paracrine and transpresentation functions of IL-15 are mediated by diverse splice form of IL-15Ralpha.
23072822 regulator of the oxidative and fatigue properties of skeletal muscle [review]
23058476 our data demonstrate the role of IL-15 in dendritic cell and endothelial cell interaction in transplant microenvironment. IL-15 may regulate how the donor first line of barrier interacts with recipient first line of defense to protect the organ survival.
22785229 IL-15 positively regulates IL-21 production in celiac disease mucosa.
22715368 IL-15+IL-12 has an immunomodulatory effect on NK cell subsets from HIV-infected individuals viz down-regulation of iNKRs, elevation of activatory receptors NKp46 and NKG2D, and induction of coreceptor NKp80.
22565311 IL-15 protected antigen-activated NKT cells from hypoxia, and transgenic expression of IL-15 in adoptively transferred NKT cells dramatically enhanced their antimetastatic
22563505 Data show that infection of melanoma cells with delNS1-IL-15 resulted in the production of high levels of biologically active IL-15.
22537815 there is an altered expression of LIF and IL-15 in the endometrium of women with recurrent implantation failure
22535664 The respective production of IL-15 and IL-10 explains the contrasting effects of Langerhans cells and dermal CD14(+) dendritic cells on CD8(+) T-cell priming.
22510877 Human Langerhans cells use an IL-15R-alpha/IL-15/pSTAT5-dependent mechanism to break T-cell tolerance against the self-differentiation tumor antigen WT1.
22496150 In lymphodepleted cancer patients, the serum IL-15 is exclusively present in its heterodimeric form.
22471460 Polymorphisms of IL-15 is not associated with Non-Small-Cell Lung Carcinoma.
22467658 Differential transcription factor use by the KIR2DL4 promoter under constitutive and IL-2/15-treated conditions.
22447977 IL-15 can signal via IL-15Ralpha, JNK, and NF-kappaB to drive RANTES production by myeloid cells.
22440823 These single-nucleotide polymorphisms were also significant after correction for multiple testing. CONCLUSION: Genetic variants in IL-15 are associated with progression of joint destruction in rheumatoid arthritis
22363690 These data highlight the central role of IL-15 and gammac-receptor signaling in renal homeostasis.
22261234 synergistic effect of IL-21 and IL-15 in enhancing cytokine production and cytotoxic function of CD8+ T cells, IL-21 may be potent immunomodulator in conjunction with IL-15 to regulate umbilical cord blood CD8+ T cells homeostasis and effector functions.
22242124 Patients with early arthritis displaying high baseline serum IL-15 suffered a more severe disease and received more intensive treatment.
22084435 Bcl-xL overexpression restores natural killer (NK)T cell development in IL-15-deficient mice; overall, IL-15 relays specific, Bcl-xL-dependent survival signals during NKT cell ontogeny.
22055728 This study highlights some important effects of IL 15 on natural killer cells in HIV patients.
21988722 IL-15 genetic variants can affect resistance or susceptibility to human brucellosis among Iranian patients (interleukin 15 )
21984699 This study directly examines proximal signaling by transgenic IL-2 and IL-15 and CD8-positive T cell primary and memory responses as a consequence of varied CD122-dependent signaling.
21973023 enhancement of cell-mediated cytotoxicity against acute lymphoblastic leukemia/lymphoma cell lines as well as against primary acute myeloid and defined lymphoblastic leukemia cells
21967803 GNLY-expressing lymphocytes, probably attracted by IL-15, not only participate partially in myocardial cell apoptosis, but also hasten resolution of cardiac leucocyte infiltration in patients with myocardial infarction.
21945396 IL-15, which is important for development of IgG-ASCs, decreases the number of IgE-ASCs when added to media commonly used for in vitro development of IgE-ASCs.
21943235 Expression IL-7 and IL-15 genes in prostate tissues and corresponding serum titres are significantly increased in patients with early stage prostate cancer as compared with patients with benign prostatic hyperplasia.
21925225 differs from IL-2 in the effect on the development, activation, and proliferation of NK cells
21911607 elevated levels of IL-15 in patients relative to controls, the greater susceptibility of CD8 T cells from patients to IL-15, in addition to the enhanced cytotoxic responses by IL-15-exposed CD8 T cells
21852331 Respiratory synctial virus increased IL-15 production in respiratory epithelial cells via virus replication and NF-kB-dependent mechanisms.
21813181 IFN-alpha boosts signaling and functional effects of IL-15, at least in part by fostering the increased IL-15R expression
21788945 cooperation between IL-15 and CD40L reinforces the importance of tumor microenvironment and unravels a mechanism of FL growth that should be considered if using IL-15 as a drug in this disease
21779162 Deficient IL-15 production in asthma may be important in the pathogenesis of asthma exacerbations.
21769475 These findings indicate that the expression of IL-15 up-regulated by IL-6 is associated with MAPKs-ERK1/2 and PI3K-AKT signaling pathways in HaCaT cells.
21765616 a novel inflammatory crosstalk between natural killer cells and eosinophils via IL-15/IL-8 axis that can be modulated by vitamin D(3)
21724805 Monocytes differentiated with GM-CSF and IL-15 initiate Th17 and Th1 responses that are contact-dependent and mediated by IL-15.
21723324 along with dendritic cells induce proliferation of CD4+CD25+ regulatory T cells from peripheral blood
21715685 Natural killer (NK) cell homeostasis, mature NK cell differentiation, and acquisition of Ly49 receptor and effector functions require different levels of transgenic IL-15 trans-presentation input to achieve full status
21572025 alternating between mucosal and systemic deliveries of the identical influenza virus prompts change in IL-15 dependence, necessitating a re-evaluation of the current model of CD8 T(mem) maintenance
21562158 IL-15-inducible molecules Bcl-x(L), MIP-1alpha, MIP-1beta, and CCR5 were upregulated in the human bone marrow
21539877 Post-thymic regulation of CD5 levels in human memory T cells is inversely associated with the strength of responsiveness to interleukin-15.
21487524 In conclusion, our data suggest that IL-15 may contribute to atherosclerotic plaque integrity by stimulation of smooth muscle cells, probably in a platelet-derived growth factor dependent fashion.
21474552 found that IL-15 could overcome CD4(+) Th deficiency to induce primary and recall memory CD8(+) T cell responses in healthy individuals
21334074 potential biomarker to document the local pre-conception environment for assisted fertilization
21307608 IL-15 might play a role in the systemic anti-obesogenic and insulin-sensitizing effects of endurance exercise, not only as a paracrine and autocrine but also as an endocrine factor.
21300928 Report elevated IL-15 in primary myelofibrosis.
21242188 Studies indicate that reciprocal membrane-bound IL-15 trans-presentation commits these cells into NK differentiation.
21204897 Th17 cells from the rheumatoid arthritis synovial tissue were enriched in the CD4+ CCR6+ population, and they were sensitive to exogenous IL-15
21190865 Data show that in patients with PsA, serum TWEAK, IL-15, MCP-1 and MMP-3 levels were significantly elevated.
21169670 the aim of this review is to assess as preventive and therapeutic target the role of IL-15 and selenium in the pathogeneses of both celiac disease and autoimmune thyroid diseases--REVIEW
21132303 Elevation of IL-15, sIL2-R and sTNF-R1 in active patients provides preliminary evidence for the activation of inflammatory response during PM/DM flares.
21074481 Current understanding of IL-15 role in immune-mediated and infectious diseases as well as its therapeutic use.
21049047 findings suggest that IL-15 gene polymorphisms are significantly associated with ALL in adult Chinese population
21049047 Observational study of gene-disease association. (HuGE Navigator)
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20956026 induces CD8+ T cells to acquire functional NK receptors capable of modulating cytotoxicity and cytokine secretion
20736143 Serum IL-15 levels were increased in a subpopulation of patients with early arthritis, indicating that this measure may serve as a biomarker for this condition
20732850 IL-15 counteracted TGF-beta1-mediated alpha-SMA expression. Moreover, TGF-beta1-induced expression of collagen, fibronectin and connective tissue growth factor was attenuated by addition of IL-15
20671116 IL-2, IL15 and IL-15Ralpha-IgG1-Fc complexes significantly enhanced NK and CD8(+) T cells proliferation and cytotoxicity.
20670353 K562-MICA-4-1BBL-IL-15 cells would be developed for expansion of NK cells ex vivo and may have important implications for clinical immunotherapy.
20631381 Recombinant human IL-15 administered to macaques generates a dramatic expansion of short-lived memory CD8 T cells and natural killer cells in immunocompetent macaques and has long-term effects on the balance of CD4(+) and CD8(+) T cells.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20622171 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20568250 Observational study of gene-disease association. (HuGE Navigator)
20560915 increased expression in the decidua of patients with recurrent miscarriage
20538758 IL-15 can have innate anti-tumor activity independent of natural killer cells and CD8(+) T cells and the common gamma(c)R.
20503287 Observational study of gene-disease association. (HuGE Navigator)
20483740 T cell development is impaired by Id2, most likely by sequestering HEB, whereas NK cell development is promoted by increasing a pool of CD1a-CD5+ NK cell progenitors, which together with IL-15 differentiate into mature NK cells
20453000 Observational study of gene-disease association. (HuGE Navigator)
20444155 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20430958 Adenovirus dendritic cells and matured dendritic cells can efficiently promote innate immune functions by activation of NK cells through the cooperative activities of tmTNF and trans-IL-15 mediated by cell-to-cell contact.
20414345 the survival benefit observed by IL-15 is most likely mediated by enhanced NK cell recovery post-autologous peripheral blood hematopoietic stem cell transplantation
20381491 IL-15 mediates in the pathogenesis of eosinophilic esophagitis (EoE). IL-15 activates CD4(+) T cells to produce cytokines that act on eosinophils.
20331472 report that interleukin-15 (IL-15) enhances human primary follicular dendritic cell proliferation and regulates cytokine secretion.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20190192 IL-7 and IL-21 are superior to IL-2 and IL-15 in promoting human T cell-mediated rejection of systemic lymphoma in immunodeficient mice.
20166880 Altered expression of CD30 and the Il-15 regulation of CD30 highlight the occurrence of peripheral manifestations of celiac disease.
20153259 Genetic and/or environmental factors that control IL-15 expression and responsiveness in the intestine likely participate in the pathogenesis of celiac disease.
20142427 Overexpression of IL-15 in intestinal epithelial cells expanded NK1.1(+) cells within the gut but had no effect on absolute numbers of the CD127(+)NK1.1(-)Rorc(+) subset of CD3(-)NKp46(+) cells
20140262 Observational study of gene-disease association. (HuGE Navigator)
20083555 Observational study of gene-disease association. (HuGE Navigator)
20043070 Recombinant adenovirus-associated vector serotype 2-Human interleukin 15 appears as a new potential therapeutic tool for breast cancer immunotherapy.
20012528 Unactivated memory CD4+ T cells infected by HIV-1 in the presence of IL-2 and IL-15 alone or IL-6/IL-7/TNF-alpha combination, upregulate granzyme B and HIV-1 CA production
20007590 Synovial fibroblast IL-15 from rheumatoid arthritis patients exerts a dual action on the equilibrium between regulatory T (Treg) and responder T cells by potentiating the suppressive effect of Treg while augmenting the proinflammatory action of Tresp.
19949092 IL-15 plays an important role in dictating the composition rather than simply the maintenance of the CD8 memory pool.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19835475 High concentrations of interleukin 15 in breast milk are associated with protection against postnatal HIV transmission
19821081 IFN-gamma and TNF-alpha play an important role in regulating the expression of IL-15 and IL-15Ralpha on the surface of HUVECs.
19796965 Data support the hypothesis that genetic variation in IL-15 gene and IL-15 levels influence the risk of coronary heart disease.
19773279 Observational study of gene-disease association. (HuGE Navigator)
19756346 the +20A > G, +13467C > A, +13653A > T, and +13815A > T SNPs in the IL-15 gene affect bone mineral density and, thus, could be genetic markers of osteoporosis
19756346 Observational study of gene-disease association. (HuGE Navigator)
19710458 gammadelta T lymphocytes with regulatory functions (Vdelta2 Tregs) are induced in vitro in the presence of specific Ag stimulation and cytokines TGF-beta1 and IL-15.
19703339 Our findings suggest a possible role of IL-15 and RANTES in MS. Treatment with methylprednisolone in relapse had no effect on serum IL-15 and RANTES levels.
19696432 Whereas the long signal peptide of IL-15 can be detected efficiently in the extracellular compartment, IL-15 short signal peptide is strictly found intracellularly and is detected both in the cytoplasm and the nucleus of DNA-transfected cells.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19657406 Levels of IFNgamma, TNFalpha, IL-6, IL-15, IL-18, and IL-23 were increased (above healthy controls) in both affected and unaffected areas from Inflammatory Bowel Diseas.
19625176 Observational study of gene-disease association. (HuGE Navigator)
19593212 Observational study of gene-disease association. (HuGE Navigator)
19592095 cigarette smoke compromises IL-15 production and as a result NK cell function which could link to the higher incidence of cancers or viral infections observed among smokers.
19573080 Observational study of gene-disease association. (HuGE Navigator)
19570824 Perforin activation is mediated by a cysteine protease and IL-15; the combination of IL-15 plus SCF is sufficient to coordinate the development of the NK cell surface phenotype with the expression and proteolytic activation of the cytotoxic machinery
19546878 data implicate a role for small percentages of NK cells in the enhanced capacity of IL-15 monocyte-derived dendritic cells to induce tumour-specific cytotoxic T-lymphocyte independent of IL-12p70.
19527514 Observational study of gene-disease association. (HuGE Navigator)
19505916 Observational study of gene-disease association. (HuGE Navigator)
19449444 Unactivated memory CD4+ T cells infected by HIV-1 in the presence of IL-2 and IL-15 alone or IL-6/IL-7/TNF-alpha combination, upregulate granzyme B and HIV-1 CA production
19414780 These findings define a common cytokine receptor expression program, which increases human NK cell sensitivity to free IL-15 in early activation and redirects responses toward IL-2 and trans-presented IL-15 at later stages
19414770 we demonstrate that stimulation of human cord blood CD34(+) cells by a Notch ligand but no IL-15, in a stroma-free culture induced the generation of cells with characteristics of functional NK cells
19414768 hepatocytes and IL-15 create a favorable microenvironment for T cells to growth and survive.
19406127 These analyses unveiled a novel and critical role for residue Tyr26 of IL-15 in the interaction with IL-15R alpha, which facilitates desolvation of key charged residues during the assembly of the complex.
19325034 DC expression of membrane-bound form of IL-15, which is only partially associated with IL-15R molecules, is essential to promote specific CD8(+) T lymphocyte response in the absence of DC-derived IL-12.
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19247692 Observational study of gene-disease association. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
19237603 Cytosolic phospholipase A(2) (cPLA(2)) is identified as a central molecule in NKG2D-mediated cytolysis in cytotoxic T lymphocytes.
19233474 Genetic treatment with pIL-15 and pIL-21 in the presence or absence of cognate antigen can contribute to immune-enhancement against HSV.
19188921 This study identified a group of SNPs, upstream from the IL15 gene, which were associated with both smoking status and quantity of cigarette consumption.
19188921 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19176441 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19133918 These results suggest that IL15 gene variants do not play an important role in the development for asthma or other atopic disorders.
19133918 Observational study of gene-disease association. (HuGE Navigator)
19088135 The decidual leucocytes also up-regulated IL-15 and IL-15Ralpha in stromal fibroblasts which could produce a niche for uNK cells allowing proliferation within and recruitment into the uterus.
19047106 CX3CL1, IL-15, and CCL4 can serve as independent predictors of biochemical recurrence.
19019335 Observational study of gene-disease association. (HuGE Navigator)
19013323 Unactivated memory CD4+ T cells infected by HIV-1 in the presence of IL-2 and IL-15 alone or IL-6/IL-7/TNF-alpha combination, upregulate granzyme B and HIV-1 CA production
18981132 IL-15 links TLR2/1-induced macrophage differentiation to the vitamin D-dependent antimicrobial pathway.
18840707 The Axl/Gas6 pathway is required for optimal cytokine signaling during human natural killer cell development.
18818748 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18782269 there is an auto-inhibitory mechanism controlling cellular IL-15 levels.
18706446 Cytokines related to activity of the innate immune response were most prominent in this study and showed good correlation with each other. In particular, it was shown that IL-15 was raised in Behcet's disease
18697873 IL-15 may be a regulator of trunk fat mass; negative associations are found between muscle IL-15 mRNA and obesity parameters
18676680 Observational study of gene-disease association. (HuGE Navigator)
18656487 The soluble IL-15Ralpha sushi domain-IL-15 fusion protein is therefore able to bind and activate both the IL-15Rbeta/gamma and the IL-15Ralpha/beta/gamma receptors.
18633131 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18583567 HSV-1 induces TLR2-dependent activation of IL-15 gene expression, which requires the recruitment of both MyD88 and TIRAP/Mal and the activation of IRAK1 and TRAF6 leading to NF-kappaB translocation to the nucleus.
18580966 analysis of heterogeneity in polymorphisms in the interleukin-15 gene in psoriasis patients
18580966 Observational study of gene-disease association. (HuGE Navigator)
18524812 Data show that mRNA expression of IL-15 was significantly increased throughout the window of implantation.
18523245 IL-15 is of central importance in activating natural killer (NK) cells during the rejection response in a stringent skin transplant model that uses recombination activating gene (Rag)-deficient mice.
18514540 Potential involvement with muscle and bone phenotypes and predictors of metabolic syndrome.
18514540 Observational study of gene-disease association. (HuGE Navigator)
18509087 expression of IL-15, which induced degranulation and IFN-gamma production in HTLV-I infected patients, was enhanced on surface of CD14(+) cells in /tropical spastic paraparesis patients.
18505820 Interleukin-15 (IL-15) translocation into the endoplasmic reticulum occurs independently of the presence of IL-15 receptor alpha (IL-15R alpha).
18493981 IL-15 acts as a potent inducer of CD4(+)CD25(hi)FOXP3(+) cells in the periphery, and suggests a potential role for IL-15 in blunting immune activation.
18493613 examination of role in regulating a novel regulatory natural killer cell subset from peripheral blood CD34 progenitors
18482208 IL-15 plays a role in RA
18431516 Data show that T cell loss after islet transplantation in patients with autoimmune type 1 diabetes was associated with both increased serum concentrations of IL-7 and IL-15 and in vivo proliferation of memory CD45RO(+) T cells.
18424079 Interleukin 15 96516A>T and IL15 96330C>A gene polymorphisms are reported in Caucasian patients with chronic plaque psoriasis.
18419254 These observations suggest that lower measles-specific T-cell immune responses elicited by measles vaccine in infants may be due to diminished levels of IL-12 and IL-15.
18365236 IL-15 may act as an anti-apoptotic molecule in pneumococci infection, thereby suggesting IL-15 as a benefical cytokine in pulmonary host defense against infection.
18348982 IL-2 and IL-15 differentially regulate PI3K and IL-17RA
18311795 Interaction of natural killer cells with fibroblast-like synoviocytes results in increased IL-15 expression by fibroblast-like synoviocytes and production of proinflammatory chemokines, cytokines, and MMPs, which may contribute to joint inflammation.
18295891 IL-15 played a crucial role in sustaining long-lasting functions of CD56(dim) NK cells.
18280748 results show that IL-15 can improve the function of NK cells via up-regulating NKG2D expression, and also augmenting the expression of cytotoxic effector molecules and the phosphorylation of STAT1 and ERK1/2, which may also contribute the NK lysis
18275895 in NK cells cultured with IL-15, we observed an up-regulation of the activating receptors NKG2D, NKp30, and NKp46, associated with an increase in anti-tumor lytic activity.
18086532 IL-15 is a potent stimulant of antifungal activities in human neutrophils, at least in part by a mechanism dependent on oxidative metabolism.
17986095 The PD group presented with significantly increased RANTES levels as compared to the control group (P = 0.0009). No difference was observed as regards IL-15 levels.
17982063 IL-15 has dual roles in maintaining IL-7Ralpha(low)CCR7(-) memory CD8(+) T cells via TCR-dependent and -independent mechanisms.
17964972 IL-15 and IL-18 are not part of the mechanism of the response of human placenta to LPS
17947730 High interleukin-15 expression is associated with childhood acute lymphoblastic leukemia with involvement of the Central Nervous System
17938255 IL-15 but not IL-21 caused an increased phosphorylation of Shc and ERK1/2.
17703412 Observational study of gene-disease association. (HuGE Navigator)
17655329 IL-15 and IL-15Ralpha complex is 10-fold more active than IL-15 alone in stimulating proliferation and survival of memory phenotype CD8 T cells.
17635814 Survival cytokines IL-15 and IL-7 are differentially involved in the growth and maintenance of heart-infiltrating peripheral CD8-positive T cells from patients with chronic Chagas disease cardiomyopathy.
17616399 Observational study of gene-disease association. (HuGE Navigator)
17616399 IL-15 polymorphisms do not appear to play a major role in genetic predisposition to rheumatoid arthritis in this population of Spanish Caucasian origin.
17554368 IL-15 genetic variants play an important role in the pathogenesis of psoriasis, probably by increasing interleukin production and inflammation in the lesions of psoriasis.
17537415 an elevation in serum IL15 is observed in women who have already developed preeclampsia, implying that the increase results from the pathology of preeclampsia
17431094 Unactivated memory CD4+ T cells infected by HIV-1 in the presence of IL-2 and IL-15 alone or IL-6/IL-7/TNF-alpha combination, upregulate granzyme B and HIV-1 CA production
17363780 epithelial-derived IL-15 has a role in transforming monocytes into dendritic cells
17324400 IL-15 impaired Smad3-dependent TGF-beta signaling in human T lymphocytes downstream from Smad3 nuclear translocation.
17158609 Respiratory syncytial virus (RSV)-induced up-regulation of IL-15 expression in THP-1 cells involves the phosphorylation of PKC-alpha/beta.
17142786 an impaired, but not abolished, survival response to IL-2 and IL-15 accounts for the persistent lack of NK cells and the transient CD8 alphabeta T lymphopenia associated with familial NK cell deficiency
17110377 IL-2 has a distinct inductive effect on APOBEC3G (A3G) deoxycytidine deaminase gene expression and A3G complex assembly that occur in natural cellular targets of human immunodeficiency virus infection.
17077296 Unactivated memory CD4+ T cells infected by HIV-1 in the presence of IL-2 and IL-15 alone or IL-6/IL-7/TNF-alpha combination, upregulate granzyme B and HIV-1 CA production
17001647 Refined molecular modeling of the docking of IL-15 to the sushi domain of IL-15R.
16791279 Novel IL-15 isoforms generated by alternative splicing are expressed in the intestinal epithelium.
16772281 Follicular fluid collected from spontaneous cycles contains detectable levels subunit IL-15.
16670327 Irradiated MyD88-deficient IL-15 transgenic mice transferred with wild-type bone marrow cells have increased numbers of CD8alphaalpha TCRalphabeta and TCRgammadelta subsets in the intestinal intraepithelial lymphocytes.
16629787 Observational study of gene-disease association. (HuGE Navigator)
16606671 Endogenous IL-15 plays a key role in rendering resident naive CD4 T cells susceptible to HIV infection.
16507118 After infliximab therapy, the expression of IL-15 was increased in four patients and reduced in five with rheumatoid arthritis.
16474399 Molecular and cellular analysis showed that tolerant T cells expressed the IL-15 receptor alpha chain, and could be induced to proliferate in vitro in response to exogenous IL-15.
16427155 Unactivated memory CD4+ T cells infected by HIV-1 in the presence of IL-2 and IL-15 alone or IL-6/IL-7/TNF-alpha combination, upregulate granzyme B and HIV-1 CA production
16333313 Observational study of gene-disease association. (HuGE Navigator)
16284400 A recombinant, soluble domain of IL-15 rece[tpr al[ha, which bears most of the binding affinity for IL-15, behaves as a potent IL-15 agonist.
16273100 Induces local chromatin modifications specific for the T-cell antigen receptor variable gamma-region gene segment and enhanced accessibility conducive to subsequent targeted gene rearrangement.
16148110 human T cells constitutively express IL-15 that acts through autocrine/juxtacrine loops to promote ex vivo homeostatic T cell proliferation.
16136475 important role in activating an NK cell-mediated pathway that leads to the elimination of intracellular protozoans from intestines
16109314 Data suggest that a systemic inflammatory response involving IL-15 might be involved in the occurrence of cardiovascular disease in patients with essential hypertension.
16098919 Associations between IL-15 serum level and long-term diabetic control lead to the speculation that IL-15 may serve as a target for future treatment in patients with prediabetes and/or for prevention of late diabetic complications.
16060678 A quantitative relationship is established between receptor alpha subunit binding affinity and mitogenic activity for IL-15 and IL-2.
16024007 short-term exposure of CD56+ cells to IL15/IL12 or IL15/IL18 at 8-day intervals may hold a promise for improved clinical results in cellular adoptive cancer immunotherapy
15993713 Anergy induction by IL-7 and restoration of responsiveness by IL-15 suggest novel mechanisms for regulation of helper T-cell responses, induction of peripheral tolerance, and breakdown of T-cell self-tolerance.
15976176 IL-15 but not IL-2 may have a role in xenogeneic graft-versus-host disease
15943034 Production of IL-15 and/or TGF-alpha was also associated with amphoterin mRNA expression in colon cancer tissues with tumor-associated macrophages depletion
15857508 Unactivated memory CD4+ T cells infected by HIV-1 in the presence of IL-2 and IL-15 alone or IL-6/IL-7/TNF-alpha combination, upregulate granzyme B and HIV-1 CA production
15778359 IL-15 activates stable telomerase expression and compensates telomere loss in memory phenotype CD8(+) T cells, and telomerase may play an important role in memory CD8(+) T cell homeostasis.
15770395 Data suggest that the IL-15 and IL-15R system may play important roles in the activation and differentiation of lamina propria B cells in patients with infammatory bowel disease, especially in those with ulceratie colitis.
15713701 endogenous IL-15 in secretory phase endometrium plays a central role in postovulatory recruitment of PB CD16(-) NK cells into the human endometrium.
15710591 AKT and IL-15 may be important in extranodal NK/T-cell lymphoma tumor survival
15598425 IL-15 alters expression and function pf the chemokine receptor CX3CR1 in human NK cells.
15563472 Interleukins 2 and 15 regulate Ets1 expression via ERK1/2 and MNK1 in human natural killer cells
15557159 IL-15 from follicular dendritic cells, in membrane-bound form, plays an important role in supporting germinal center(GC)-B cell proliferation, proposing a new target for immune modulation as well as treatment of B cell tumors of GC origin.
15536127 membrane-bound IL-15 on dendritic cells was essential for NK cell proliferation and survival
15531573 IL-15 is an important mediator of muscle mass response to resistance exercise training in humans
15358647 effects of IL15 on neonatal NK cells was examined for up to 12 weeks in culture; effect on antibody-dependent cellular cytotoxicity using CEM cells coated with HIV gp120 antigen
15353479 dendritic cell-produced IL-2 is tightly coregulated with the expression of IL-15.
15347678 Interleukin (IL)-15 and IL-2 reciprocally regulate expression of the chemokine receptor CX3CR1 through selective NFAT1- and NFAT2-dependent mechanisms
15328153 Combined with CpG dinucleotide induced maximal activation of NK cells and further enhanced activation of CD8 T cells, possibly enhancing antitumor immunity in cutaneous T-cell lymphoma.
15225634 Recombinanat human IL-15 seems to be able to reduce/suppress protein loss and apoptosis related to muscle wasting during cancer cachexia in experimental animals.
15131572 single nucleotide polymorphisms in the IL-15 gene and their association with inflammatory and/or atopic phenotypes
15039446 IL-15 has specific binding sites for interleukin-15alpha receptor, one in the B helix and the other in the C helix
15034035 Cell surface IL-15 is more than just a ligand; it can function as a receptor and participate in reverse signaling that results in cellular adhesion and production of inflammatory cytokines.
14984938 Normal ovary and ovarian tumors express IL-13 and IL-15 and pattern of their expression in carcinomas suggests that these cytokines may function in various ovarian cellular activities including inflammatory/immune responses
14982947 IL-15 does not increase IL-1alpha or IL-1beta production but induces IL-1Ra release, increases myeloid cell differentiation factor-1 stability, decreases the activity of caspase-3 and caspase-8, resulting in an inhibition of vimentin cleavage
14967307 IL-15 secreted by activated alveolar macrophages and granzyme B secreted by activated CD8+ cytotoxic T lymphocytes play important roles in the process of acute lung allograft rejection
14762166 IL-15 can improve the in vivo antitumor activity of adoptively transferred CD8(+) T cells
14684414 HIV antiviral response is mediated primarily by production of interleukin-15 by mature dendritic cells.
14662842 IL-15-expanded, de novo-induced human anergic regulatory CD4+ T cells suppress both naive and memory T cells in a superior way and are of interest in antigen-specific immunotherapy.
14648805 The anti-apoptotic effects of IL-15 may explain the rediction pf diabetes incidence in NOD mice.
14617758 results obtained with an IL-15-specific mAb support an important role for IL-15 in the pathogenesis of psoriasis
14607946 IL-15 stimulates type I interferon (IFN)-mediated dendritic cell (DC) expression of MICA/B and subsequent DC activation of natural killer cells.
14607929 Because IL-15 regulates gene expression through the interactions of transcription factors with IFN-gamma activated sequence and Ets binding site motifs, it is likely that IL-15 influences CD94 gene expression through formation of DNA-protein complexes.
14581351 IL-15 produced by metastatic colon carcinoma cells can induce hyperplasia in the mucosa adjacent to colon cancer, thus contributing to angiogenesis and progression of the disease
14499665 Interleukin-15 has a role in increasing myosin accretion in human skeletal myogenic cultures
12960322 CD34-CD133-CD7-CD45(dim)lin- hematopoietic stem cells from human umbilical cord blood display an exquisite sensitivity to IL-15 in vitro and differentiate into lymphoid/natural killer cells.
12865812 role in liver allograft rejection
12857602 IL-15 alone, similarly to IL-18, has no significant ability for regulation of both soluble IL-6 receptors, sIL-6R and sgp130, released by human neutrophils.
12847234 IL-15 up-regulates the expression of lymphocyte function-associated antigen-1 (LFA-1) in IL-7-differentiated cells and augments their cytotoxic activity.
12826231 The mixed leukcyte culture model suggest that allorecognition upregulates IL-2 but not IL-15 expression.
12805064 all human CD8+ T-cell subsets had the ability to respond to IL-15, which suggests a generic influence of this cytokine on CD8+ T-cell homeostasis in man.
12759422 Synergistic interactions between IL-15, IL-21, and IL-18 play an important role in NK and T cell functions by enhancing IFN-gamma gene expression; IL-15 efficiently stimulates STAT5 DNA binding to IFN-gamma promoter and first intron activated (GAS) site.
12757260 decreased production of IL-15 occurs despite a comparable increase in IL-15 mRNA in the PBMC of HIV-infected and healthy HIV-seronegative donors when exposed to HSV-1 in cultured cells
12747456 may play a role in the pathogenesis of cyclosporin A-induced gingival overgrowth due to its interactions with cyclosporin A and its role in apoptosis and inflammation
12734346 IL-15 has multiple effects on CD8 T cells and possesses the potential to regulate the life span of naive as well as memory CD8+ T cells in vitro.
12623850 Hematopoietic CD34+ cells secreted IL-15 that, through autocrine/paracrine loop distinct signal pathways, activated NF-kB in bone marrow and cord blood progenitors, and activated STAT3 and STAT5 in peripheral G-CSF-mobilized and BM progenitors only.
12598649 IL-15 maintains the homeostasis of peripheral V alpha 14(+) NK-T cells
12571184 Peritoneal fluid IL-15 levels are increased in women with endometriosis. IL-15 levels are inversely correlated with depth of invasion and disease stage. Possible role in early pathogenesis of endometriosis.
12542496 Unactivated memory CD4+ T cells infected by HIV-1 in the presence of IL-2 and IL-15 alone or IL-6/IL-7/TNF-alpha combination, upregulate granzyme B and HIV-1 CA production
12453470 Human and mouse IL-15 bound hu or mu IL-15Ralpha with equal high affinity in the presence or absence of IL-2Rbetagamma c and exhibited similar proliferative activities on cells containing all three subunits
12421959 IL-15 is required for expression of granulysin-mediated anticryptococcal activity in CD8 T cells.
12401478 IL-15 has been shown to regulate the homeostasis of both innate and adaptive immune cells [review]
12393488 enhances survival, proliferation, and function of HIV-specific CD8+ T cells
12391205 Administration of exogenous IL-15 for 1 wk significantly augmented the expansion of the primary responding CD8+ T cell population in a murine vaccine model.
12297341 role of CD28 and IL-12/IL-15 signaling impairment in T cell proliferative deficiency during senescence
12237122 These results suggest that IL-15 is a potent regulator of iNOS expression by HGEC and involved in innate immunity in the mucosal epithelium.
12165497 Fibroblast-like synoviocytes from rheumatoid arthritis patients express functional IL-15 receptor complex: endogenous IL-15 in autocrine fashion enhances cell proliferation and expression of Bcl-x(L) and Bcl-2.
12147628 increased production of IL-15 in muscle cells in polymyositis and dermatomyositis
12115611 il15 induce anti-tumor immune response
12114302 mRNA for IL-15 isoforms was constitutively expressed in all tested human fetal brain structures, indicating a role in their development and physiology.
12089714 Observational study of gene-disease association. (HuGE Navigator)
12089333 Unactivated memory CD4+ T cells infected by HIV-1 in the presence of IL-2 and IL-15 alone or IL-6/IL-7/TNF-alpha combination, upregulate granzyme B and HIV-1 CA production
11972069 IL-15 mimics T cell receptor crosslinking in the induction of cellular proliferation, gene expression, and cytotoxicity in CD8+ memory T cells.
11919076 Interleukin-15 inhibits spontaneous apoptosis in human eosinophils via autocrine production of granulocyte macrophage-colony stimulating factor and nuclear factor-kappaB activation.
11876762 Endogenous IL-15 plays a role in the suppression of TH2-type cytokines in acute visceral leishmaniasis patients.
11814312 role of IL-15 in the regulatory function of PMN associated with IL-1beta-mediated reactions in normal conditions and, to a lesser extent, in a tumour-bearing host.
11751999 Decreased IL-15 may contribute to elevated IgE and acute inflammation in atopic dermatitis
11702064 role in cytokine production by antigen-presenting cells
11122241 Unactivated memory CD4+ T cells infected by HIV-1 in the presence of IL-2 and IL-15 alone or IL-6/IL-7/TNF-alpha combination, upregulate granzyme B and HIV-1 CA production
10388525 Unactivated memory CD4+ T cells infected by HIV-1 in the presence of IL-2 and IL-15 alone or IL-6/IL-7/TNF-alpha combination, upregulate granzyme B and HIV-1 CA production

AA Sequence

MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHID      1 - 70
ATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELE     71 - 140
EKNIKEFLQSFVHIVQMFINTS                                                    141 - 162
//

Text Mined References (354)

PMID Year Title
27129235 2016 Short Term Hypoxia Synergizes with Interleukin 15 Priming in Driving Glycolytic Gene Transcription and Supports Human Natural Killer Cell Activities.
27097762 2016 Virtual memory T cells develop and mediate bystander protective immunity in an IL-15-dependent manner.
26719339 2016 Configuration-dependent Presentation of Multivalent IL-15:IL-15R? Enhances the Antigen-specific T Cell Response and Anti-tumor Immunity.
26675759 2015 Transpresentation of interleukin-15 by IL-15/IL-15R? mRNA-engineered human dendritic cells boosts antitumoral natural killer cell activity.
26625316 2016 Cooperative therapeutic anti-tumor effect of IL-15 agonist ALT-803 and co-targeting soluble NKG2D ligand sMIC.
26567920 2015 IL-15 functions as a danger signal to regulate tissue-resident T cells and tissue destruction.
26481260 2015 Interleukin-15 enhances the expansion and function of natural killer T cells from adult peripheral and umbilical cord blood.
26479922 2015 Hair follicle-derived IL-7 and IL-15 mediate skin-resident memory T cell homeostasis and lymphoma.
26464654 2015 Expression and correlation of matrix metalloproteinase-7 and interleukin-15 in human osteoarthritis.
26453750 2015 NK Cell Proliferation Induced by IL-15 Transpresentation Is Negatively Regulated by Inhibitory Receptors.
26255115 2015 Downregulation of STAT3 phosphorylation enhances tumoricidal effect of IL-15-activated dendritic cell against doxorubicin-resistant lymphoma and leukemia via TNF-?.
26241055 2015 Inflammatory IL-15 is required for optimal memory T cell responses.
26141233 2015 IL-15 induces strong but short-lived tumor-infiltrating CD8 T cell responses through the regulation of Tim-3 in breast cancer.
26136429 2015 TLR-9 and IL-15 Synergy Promotes the In Vitro Clonal Expansion of Chronic Lymphocytic Leukemia B Cells.
26085358 2015 Effects of Immunoregulatory Cytokines (IL-2, IL-7, and IL-15) on Expression of Gfi1 and U2afll4 Genes in T Cells at Different Stages of Differentiation.
26046663 2015 IL-15 dependent induction of IL-18 secretion as a feedback mechanism controlling human MAIT-cell effector functions.
26025664 2015 Transmembrane-Bound IL-15-Promoted Epithelial-Mesenchymal Transition in Renal Cancer Cells Requires the Src-Dependent Akt/GSK-3?/?-Catenin Pathway.
25964490 2015 IRF-1 promotes liver transplant ischemia/reperfusion injury via hepatocyte IL-15/IL-15R? production.
25907558 2015 Stress-activated Dendritic Cells (DC) Induce Dual Interleukin (IL)-15- and IL1?-mediated Pathways, Which May Elicit CD4+ Memory T Cells and Interferon (IFN)-stimulated Genes.
25902870 2015 Exercise-stimulated interleukin-15 is controlled by AMPK and regulates skin metabolism and aging.
25879761 2015 Differential expression of pro-inflammatory cytokines IL-15Ralpha, IL-15, IL-6 and TNFalpha in synovial fluid from rheumatoid arthritis patients.
25736261 2015 The shared and contrasting roles of IL2 and IL15 in the life and death of normal and neoplastic lymphocytes: implications for cancer therapy.
25627006 2015 Combined therapy with CTL cells and oncolytic adenovirus expressing IL-15-induced enhanced antitumor activity.
25617471 2015 IL-15 amplifies the pathogenic properties of CD4+CD28- T cells in multiple sclerosis.
25582338 STAT3 signaling contributes to the high effector activities of interleukin-15-derived dendritic cells.
25577895 2013 The effect of IL-2, IL-12 and IL15 on the function of natural killer cells in children suffering from type 1 diabetes mellitus.
25486870 2015 The IL-15 cytokine system provides growth and survival signals in Hodgkin lymphoma and enhances the inflammatory phenotype of HRS cells.
25481744 2015 Human regulatory T-cell development is dictated by Interleukin-2 and -15 expressed in a non-overlapping pattern in the thymus.
25428383 2015 Increased serum levels of interleukin-15 correlate with negative prognostic factors in extranodal NK/T cell lymphoma.
25416956 2014 A proteome-scale map of the human interactome network.
25412359 2014 NK cell activation in human hantavirus infection explained by virus-induced IL-15/IL15R? expression.
25080789 2014 [The immunologic predictors of effect of anti-B-cell therapy under rheumatoid arthritis].
25080481 2014 Nanoparticle-mediated combinatorial targeting of multiple human dendritic cell (DC) subsets leads to enhanced T cell activation via IL-15-dependent DC crosstalk.
25006133 2014 Autonomous growth and increased cytotoxicity of natural killer cells expressing membrane-bound interleukin-15.
24953855 2014 p21WAF1 mediates the IL-15-induced migration and invasion of human bladder cancer 5637 cells via the ERK1/2/NF-?B/MMP-9 pathway.
24912180 2014 IL-15.IL-15R? complex shedding following trans-presentation is essential for the survival of IL-15 responding NK and T cells.
24805144 2014 IL-15: a novel prosurvival signaling pathway in cardiomyocytes.
24795032 2014 IL15 is linked to antitumor immune responses in colorectal cancer.
24777763 2014 NK cells are primed by ANRS MVA(HIV)-infected DCs, via a mechanism involving NKG2D and membrane-bound IL-15, to control HIV-1 infection in CD4+ T cells.
24762213 2014 A promoter polymorphism (rs3806798) of interleukin-15 gene is associated with chronic hepatitis B virus infection in the Chinese Han population.
24748538 2015 Interleukins 15 and 12 in combination expand the selective loss of natural killer T cells in HIV infection in vitro.
24737791 2014 Molecular pathways: interleukin-15 signaling in health and in cancer.
24721706 2014 hIL-15 gene-modified human natural killer cells (NKL-IL15) augments the anti-human hepatocellular carcinoma effect in vivo.
24700781 2014 Interleukin-15 enhances cellular proliferation and upregulates CNS homing molecules in pre-B acute lymphoblastic leukemia.
24689757 2015 Influence of interleukin-15 polymorphism on the survival of adult patients with acute lymphoblastic leukemia in Egypt.
24670802 2014 BAFF suppresses IL-15 expression in B cells.
24666229 2014 Serum cytokine and chemokine profiles in patients with myasthenia gravis.
24657713 Human monocytes have increased IFN-?-mediated IL-15 production with age alongside altered IFN-? receptor signaling.
24621498 2014 IL-15 and IL-17F are differentially regulated and expressed in mycosis fungoides (MF).
24603895 2014 Interleukin-15 and soluble interleukin-15 receptor ? in coronary artery disease patients: association with epicardial fat and indices of adipose tissue distribution.
24489097 2014 Human ?? thymocytes are functionally immature and differentiate into cytotoxic type 1 effector T cells upon IL-2/IL-15 signaling.
24415300 2014 Association of the interleukin 15 (IL-15) gene polymorphisms with the risk of developing ulcerative colitis in Mexican individuals.
24394601 2014 Sampling of proximal and distal duodenal biopsies in the diagnosis and monitoring of celiac disease.
24361466 2014 Interleukin 15 and CD4? T cells cooperate to promote small intestinal enteropathy in response to dietary antigen.
24347177 2014 The activation of TLR7 regulates the expression of VEGF, TIMP1, MMP2, IL-6, and IL-15 in Hela cells.
24274595 2014 A prominent role for the IL1 pathway and IL15 in susceptibility to chronic cavitary pulmonary aspergillosis.
24198185 2014 Combining antibody-directed presentation of IL-15 and 4-1BBL in a trifunctional fusion protein for cancer immunotherapy.
24184554 2013 Homeostasis of human NK cells is not IL-15 dependent.
24086722 2013 Interleukin 15 primes natural killer cells to kill via NKG2D and cPLA2 and this pathway is active in psoriatic arthritis.
23996684 2014 Cytokine and cytokine receptor genes of the adaptive immune response are differentially associated with breast cancer risk in American women of African and European ancestry.
23950892 2013 TNF stimulates nuclear export and secretion of IL-15 by acting on CRM1 and ARF6.
23904514 2013 Regulatory role of membrane-bound form interleukin-15 on human uterine microvascular endothelial cells in circulating CD16(-) natural killer cell extravasation into human endometrium.
23904478 2013 Insulin-dependent diabetes induced by pancreatic beta cell expression of IL-15 and IL-15R?.
23873932 2013 Nuclear factor ?B2 p52 protein has a role in antiviral immunity through I?B kinase epsilon-dependent induction of Sp1 protein and interleukin 15.
23791986 2013 The role of IL-15 in gastrointestinal diseases: a bridge between innate and adaptive immune response.
23773307 2014 Relation of IL-6, IL-13 and IL-15 gene polymorphisms to the rheumatoid factors, anti-CCP and other measures of rheumatoid arthritis activity.
23700042 2013 Estrogen-related genome-based expression profiling study of uterosacral ligaments in women with pelvic organ prolapse.
23649772 2013 The role of IL15 gene variants in visceral leishmaniasis among Iranian patients.
23649624 2013 Characterization and favorable in vivo properties of heterodimeric soluble IL-15·IL-15R? cytokine compared to IL-15 monomer.
23637340 2013 IL-15 in tumor microenvironment causes rejection of large established tumors by T cells in a noncognate T cell receptor-dependent manner.
23577098 2013 Smokers with CT detected emphysema and no airway obstruction have decreased plasma levels of EGF, IL-15, IL-8 and IL-1ra.
23437070 2013 Kinetics of IL-7 and IL-15 levels after allogeneic peripheral blood stem cell transplantation following nonmyeloablative conditioning.
23417200 2013 The distinct expressions of interleukin-15 and interleukin-15 receptor ? in Behçet's disease.
23401701 2013 Interleukin-15 (IL-15) and anti-C1q antibodies as serum biomarkers for ectopic pregnancy and missed abortion.
23325887 2013 IL-7- and IL-15-mediated TCR sensitization enables T cell responses to self-antigens.
23214303 Analysis of the concentrations of interleukin 15 in amniotic fluid in the second and the third trimesters of pregnancy.
23214284 Second-trimester IL-15 and IL-18 levels in the amniotic fluid of fetuses with normal karyotypes and with chromosome abnormalities.
23160470 2013 IL-7 and IL-15 instruct the generation of human memory stem T cells from naive precursors.
23157547 2013 Interleukin-15 in gene therapy of cancer.
23153537 2012 Aberrant overexpression of IL-15 initiates large granular lymphocyte leukemia through chromosomal instability and DNA hypermethylation.
23104097 2012 Mechanistic and structural insight into the functional dichotomy between IL-2 and IL-15.
23074221 2012 Paracrine and transpresentation functions of IL-15 are mediated by diverse splice versions of IL-15R? in human monocytes and dendritic cells.
23072822 2013 From anabolic to oxidative: reconsidering the roles of IL-15 and IL-15R? in skeletal muscle.
23058476 2013 IL-15 activated human peripheral blood dendritic cell kill allogeneic and xenogeneic endothelial cells via apoptosis.
22785229 2013 IL-15 positively regulates IL-21 production in celiac disease mucosa.
22715368 2012 Effect of recombinant cytokines on the expression of natural killer cell receptors from patients with TB or/and HIV infection.
22565311 2012 IL-15 protects NKT cells from inhibition by tumor-associated macrophages and enhances antimetastatic activity.
22563505 2012 Oncolytic effects of a novel influenza A virus expressing interleukin-15 from the NS reading frame.
22537815 2012 Expression of leukaemia inhibitory factor and interleukin 15 in endometrium of women with recurrent implantation failure after IVF; correlation with the number of endometrial natural killer cells.
22535664 2012 The differential production of cytokines by human Langerhans cells and dermal CD14(+) DCs controls CTL priming.
22510877 2012 Human Langerhans cells use an IL-15R-?/IL-15/pSTAT5-dependent mechanism to break T-cell tolerance against the self-differentiation tumor antigen WT1.
22496150 2012 Circulating IL-15 exists as heterodimeric complex with soluble IL-15R? in human and mouse serum.
22471460 2011 Lack of associations of polymorphisms of IL-7R, IL-13 and IL-15 with NSCLCs in non-smoking Chinese.
22467658 2012 Differential transcription factor use by the KIR2DL4 promoter under constitutive and IL-2/15-treated conditions.
22447977 2012 IL-15 can signal via IL-15R?, JNK, and NF-?B to drive RANTES production by myeloid cells.
22440823 2012 Genetic variants in IL15 associate with progression of joint destruction in rheumatoid arthritis: a multicohort study.
22363690 2012 Interleukin-15 plays a central role in human kidney physiology and cancer through the ?c signaling pathway.
22261234 2012 Regulation of CD28 expression on umbilical cord blood and adult peripheral blood CD8+ T cells by interleukin(IL)-15/IL-21.
22242124 2011 Interleukin 15 levels in serum may predict a severe disease course in patients with early arthritis.
22084435 2011 IL-15 regulates homeostasis and terminal maturation of NKT cells.
22055728 2012 The role of IL-15 in challenging Acquired Immunodeficiency Syndrome.
21988722 2011 Association of interleukin-15 single nucleotide polymorphisms with resistance to brucellosis among Iranian patients.
21984699 2011 The basis of distinctive IL-2- and IL-15-dependent signaling: weak CD122-dependent signaling favors CD8+ T central-memory cell survival but not T effector-memory cell development.
21973023 2012 The cytotoxic potential of interleukin-15-stimulated cytokine-induced killer cells against leukemia cells.
21967803 2012 Granulysin Expression in Lymphocytes that Populate the Peripheral Blood and the Myocardium after an Acute Coronary Event.
21945396 2012 Effect of IL-15 on IgG versus IgE antibody-secreting cells in vitro.
21943235 2011 Elevated levels of circulating IL-7 and IL-15 in patients with early stage prostate cancer.
21925225 2011 Interleukin (IL)-2 and IL-15 have different effects on human natural killer lymphocytes.
21911607 2011 B cell-derived IL-15 enhances CD8 T cell cytotoxicity and is increased in multiple sclerosis patients.
21852331 2012 RSV infection modulates IL-15 production and MICA levels in respiratory epithelial cells.
21813181 2011 IFN-? primes T- and NK-cells for IL-15-mediated signaling and cytotoxicity.
21788945 2012 Monocytes and T cells cooperate to favor normal and follicular lymphoma B-cell growth: role of IL-15 and CD40L signaling.
21779162 2011 The role of IL-15 deficiency in the pathogenesis of virus-induced asthma exacerbations.
21769475 2012 Interleukin-6 up-regulates the expression of interleukin-15 is associated with MAPKs and PI3-K signaling pathways in the human keratinocyte cell line, HaCaT.
21765616 2011 Modulation of NK cell autocrine-induced eosinophil chemotaxis by interleukin-15 and vitamin D(3): a possible NK-eosinophil crosstalk via IL-8 in the pathophysiology of allergic rhinitis.
21724805 2011 Monocytes differentiated with GM-CSF and IL-15 initiate Th17 and Th1 responses that are contact-dependent and mediated by IL-15.
21723324 2011 IL-15 and dendritic cells induce proliferation of CD4+CD25+ regulatory T cells from peripheral blood.
21715685 2011 Different NK cell developmental events require different levels of IL-15 trans-presentation.
21572025 2011 Cutting edge: IL-15-independent maintenance of mucosally generated memory CD8 T cells.
21562158 2011 Human bone marrow hosts polyfunctional memory CD4+ and CD8+ T cells with close contact to IL-15-producing cells.
21539877 2011 Post-thymic regulation of CD5 levels in human memory T cells is inversely associated with the strength of responsiveness to interleukin-15.
21487524 2011 Smooth muscle homeostasis in human atherosclerotic plaques through interleukin 15 signalling.
21474552 2011 IL-15 ex vivo overcomes CD4+ T cell deficiency for the induction of human antigen-specific CD8+ T cell responses.
21334074 2011 New pre-conception immune biomarkers for clinical practice: interleukin-18, interleukin-15 and TWEAK on the endometrial side, G-CSF on the follicular side.
21307608 2011 Upregulation of circulating IL-15 by treadmill running in healthy individuals: is IL-15 an endocrine mediator of the beneficial effects of endurance exercise?
21300928 2011 Circulating interleukin (IL)-8, IL-2R, IL-12, and IL-15 levels are independently prognostic in primary myelofibrosis: a comprehensive cytokine profiling study.
21242188 2011 Membrane-bound IL-15 stimulation on peripheral blood natural kiler progenitors leads to the generation of an adherent subset co-expressing dendritic cells and natural kiler functional markers.
21204897 2011 Interleukin-15 induces interleukin-17 production by synovial T cell lines from patients with rheumatoid arthritis.
21190865 2011 Increased serum TWEAK levels in Psoriatic arthritis: relationship with disease activity and matrix metalloproteinase-3 serum levels.
21169670 2010 Selenium status and over-expression of interleukin-15 in celiac disease and autoimmune thyroid diseases.
21167836 2011 Engineering a high-affinity anti-IL-15 antibody: crystal structure reveals an ?-helix in VH CDR3 as key component of paratope.
21132303 2012 Serum concentration of interleukin 15, interleukin 2 receptor and TNF receptor in patients with polymyositis and dermatomyositis: correlation to disease activity.
21074481 2011 Role of IL-15 in immune-mediated and infectious diseases.
21049047 2010 The role of interleukin-15 polymorphisms in adult acute lymphoblastic leukemia.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20956026 2011 IL-15 induces CD8+ T cells to acquire functional NK receptors capable of modulating cytotoxicity and cytokine secretion.
20736143 2010 Characterization of serum interleukin-15 in healthy volunteers and patients with early arthritis to assess its potential use as a biomarker.
20732850 2010 Interleukin-15 attenuates transforming growth factor-?1-induced myofibroblast differentiation in human fetal lung fibroblasts.
20671116 2010 IL-15R alpha-IgG1-Fc enhances IL-2 and IL-15 anti-tumor action through NK and CD8+ T cells proliferation and activation.
20670353 2010 Ex vivo expansion of natural killer cells with high cytotoxicity by K562 cells modified to co-express major histocompatibility complex class I chain-related protein A, 4-1BB ligand, and interleukin-15.
20631381 2010 Transient and persistent effects of IL-15 on lymphocyte homeostasis in nonhuman primates.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20622171 2010 Large copy-number variations are enriched in cases with moderate to extreme obesity.
20568250 2010 Common single nucleotide polymorphisms in immunoregulatory genes and multiple myeloma risk among women in Connecticut.
20560915 2010 Placental interleukin-15 expression in recurrent miscarriage.
20538758 2010 IL-15 has innate anti-tumor activity independent of NK and CD8 T cells.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20483740 2010 Synergy between IL-15 and Id2 promotes the expansion of human NK progenitor cells, which can be counteracted by the E protein HEB required to drive T cell development.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20444155 2010 Joint influences of Acidic-Mammalian-Chitinase with Interleukin-4 and Toll-like receptor-10 with Interleukin-13 in the genetics of asthma.
20430958 2010 Virally infected and matured human dendritic cells activate natural killer cells via cooperative activity of plasma membrane-bound TNF and IL-15.
20414345 2010 Interleukin-15 affects patient survival through natural killer cell recovery after autologous hematopoietic stem cell transplantation for non-Hodgkin lymphomas.
20381491 2010 Interleukin-15 expression is increased in human eosinophilic esophagitis and mediates pathogenesis in mice.
20331472 2010 Interleukin-15 enhances proliferation and chemokine secretion of human follicular dendritic cells.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20190192 2010 IL-7 and IL-21 are superior to IL-2 and IL-15 in promoting human T cell-mediated rejection of systemic lymphoma in immunodeficient mice.
20166880 2010 Altered expression of the lymphocyte activation antigen CD30 in active celiac disease.
20153259 2010 Monocytes differentiated with IL-15 support Th17 and Th1 responses to wheat gliadin: implications for celiac disease.
20142427 2010 IL-7 and IL-15 independently program the differentiation of intestinal CD3-NKp46+ cell subsets from Id2-dependent precursors.
20140262 2010 Maternal and fetal genetic associations of PTGER3 and PON1 with preterm birth.
20083555 2010 Commonly studied polymorphisms in inflammatory cytokine genes show only minor effects on mortality and related risk factors in nonagenarians.
20043070 2010 Immunotherapy of breast cancer by single delivery with rAAV2-mediated interleukin-15 expression.
20007590 2009 A dual action of rheumatoid arthritis synovial fibroblast IL-15 expression on the equilibrium between CD4+CD25+ regulatory T cells and CD4+CD25- responder T cells.
19949092 2010 IL-15 regulates both quantitative and qualitative features of the memory CD8 T cell pool.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19835475 2009 High concentrations of interleukin 15 in breast milk are associated with protection against postnatal HIV transmission.
19821081 2009 Expression of interleukin-15 and its receptor on the surface of stimulated human umbilical vein endothelial cells.
19796965 2010 Influences of genetic variants in interleukin-15 gene and serum interleukin-15 levels on coronary heart disease.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19756346 2009 Association of IL-15 polymorphisms with bone mineral density in postmenopausal Korean women.
19710458 2009 Cutting edge: TGF-beta1 and IL-15 Induce FOXP3+ gammadelta regulatory T cells in the presence of antigen stimulation.
19703339 2010 Circulating interleukin-15 and RANTES chemokine in MS patients: effect of treatment with methylprednisolone in patients with relapse.
19696432 2009 Secretion and biological activity of short signal peptide IL-15 is chaperoned by IL-15 receptor alpha in vivo.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19657406 2009 High levels of proinflammatory cytokines, but not markers of tissue injury, in unaffected intestinal areas from patients with IBD.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19593212 2009 Novel genetic variants contributing to left ventricular hypertrophy: the HyperGEN study.
19592095 2009 Exposure to cigarette smoke suppresses IL-15 generation and its regulatory NK cell functions in poly I:C-augmented human PBMCs.
19573080 2009 Common genetic variants in candidate genes and risk of familial lymphoid malignancies.
19570824 2009 Proteolytic activation of the cytotoxic phenotype during human NK cell development.
19546878 NK cells enhance the induction of CTL responses by IL-15 monocyte-derived dendritic cells.
19527514 2009 Racial disparity in pathophysiologic pathways of preterm birth based on genetic variants.
19505916 2009 Cytokine and cytokine receptor single-nucleotide polymorphisms predict risk for non-small cell lung cancer among women.
19414780 2009 A programmed switch from IL-15- to IL-2-dependent activation in human NK cells.
19414770 2009 Notch activation induces the generation of functional NK cells from human cord blood CD34-positive cells devoid of IL-15.
19414768 2009 Hepatocytes and IL-15: a favorable microenvironment for T cell survival and CD8+ T cell differentiation.
19406127 2009 Contributions of interfacial residues of human Interleukin15 to the specificity and affinity for its private alpha-receptor.
19325034 2009 NK cells provide helper signal for CD8+ T cells by inducing the expression of membrane-bound IL-15 on DCs.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19247692 2009 Analyses of associations with asthma in four asthma population samples from Canada and Australia.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19237603 2009 Cytosolic PLA2 is required for CTL-mediated immunopathology of celiac disease via NKG2D and IL-15.
19233474 2009 IL-21 and IL-15 cytokine DNA augments HSV specific effector and memory CD8+ T cell response.
19188921 2009 Genome-wide association analyses suggested a novel mechanism for smoking behavior regulated by IL15.
19176441 2009 Genome-wide interrogation of germline genetic variation associated with treatment response in childhood acute lymphoblastic leukemia.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19133918 2009 IL15 gene variants are not associated with asthma and atopy.
19088135 2009 Paracrine effects of uterine leucocytes on gene expression of human uterine stromal fibroblasts.
19047106 2008 Chemokine markers predict biochemical recurrence of prostate cancer following prostatectomy.
19019335 2009 Spontaneous preterm birth in African Americans is associated with infection and inflammatory response gene variants.
18981132 2008 IL-15 links TLR2/1-induced macrophage differentiation to the vitamin D-dependent antimicrobial pathway.
18840707 2009 The Axl/Gas6 pathway is required for optimal cytokine signaling during human natural killer cell development.
18818748 2008 Preterm birth in Caucasians is associated with coagulation and inflammation pathway gene variants.
18782269 2008 Autoinhibition of IL-15 expression in KC cells is ERK1/2 and PI3K dependent.
18706446 2008 Serum cytokine profiles in Behçet's disease: is there a role for IL-15 in pathogenesis?
18697873 2008 Association between interleukin-15 and obesity: interleukin-15 as a potential regulator of fat mass.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18656487 2008 The exon-3-encoded domain of IL-15ralpha contributes to IL-15 high-affinity binding and is crucial for the IL-15 antagonistic effect of soluble IL-15Ralpha.
18633131 2008 Host immune gene polymorphisms in combination with clinical and demographic factors predict late survival in diffuse large B-cell lymphoma patients in the pre-rituximab era.
18583567 2008 Requirement of TLR2-mediated signaling for the induction of IL-15 gene expression in human monocytic cells by HSV-1.
18580966 2008 No association between polymorphisms in the interleukin-15 gene and early-onset psoriasis in a UK cohort suggests heterogeneity for this susceptibility locus identified in Chinese psoriasis patients.
18524812 2008 Expression of immunomodulatory genes, their protein products and specific ligands/receptors during the window of implantation in the human endometrium.
18523245 2008 The innate NK cells, allograft rejection, and a key role for IL-15.
18514540 2008 Interleukin-15 and interleukin-15R alpha SNPs and associations with muscle, bone, and predictors of the metabolic syndrome.
18509087 2008 Retrovirally induced CTL degranulation mediated by IL-15 expression and infection of mononuclear phagocytes in patients with HTLV-I-associated neurologic disease.
18505820 2008 How a cytokine is chaperoned through the secretory pathway by complexing with its own receptor: lessons from interleukin-15 (IL-15)/IL-15 receptor alpha.
18493981 2008 IL-15 acts as a potent inducer of CD4(+)CD25(hi) cells expressing FOXP3.
18493613 2008 Generation of a novel regulatory NK cell subset from peripheral blood CD34+ progenitors promoted by membrane-bound IL-15.
18482208 2008 Neutralizing IL-21 and IL-15 inhibits pro-inflammatory cytokine production in rheumatoid arthritis.
18431516 2008 Islet transplantation in patients with autoimmune diabetes induces homeostatic cytokines that expand autoreactive memory T cells.
18424079 2008 Role of the interleukin 15 96516A>T and IL15 96330C>A gene polymorphisms in Caucasian patients with chronic plaque psoriasis.
18419254 2008 Effects of interleukin-12 and interleukin-15 on measles-specific T-cell responses in vaccinated infants.
18365236 2008 Subcellular expression pattern and role of IL-15 in pneumococci induced lung epithelial apoptosis.
18348982 2008 Differential regulation of the IL-17 receptor by gammac cytokines: inhibitory signaling by the phosphatidylinositol 3-kinase pathway.
18311795 2008 Mediation of the proinflammatory cytokine response in rheumatoid arthritis and spondylarthritis by interactions between fibroblast-like synoviocytes and natural killer cells.
18295891 2008 Bcl-xL is associated with the anti-apoptotic effect of IL-15 on the survival of CD56(dim) natural killer cells.
18280748 2008 Interleukin-15 improves cytotoxicity of natural killer cells via up-regulating NKG2D and cytotoxic effector molecule expression as well as STAT1 and ERK1/2 phosphorylation.
18275895 2008 Up-regulation of NK cell activating receptors following allogeneic hematopoietic stem cell transplantation under a lymphodepleting reduced intensity regimen is associated with elevated IL-15 levels.
18086532 2008 Interleukin-15 increases Paracoccidioides brasiliensis killing by human neutrophils.
17986095 2007 Circulating interleukin-15 and RANTES chemokine in Parkinson's disease.
17982063 2007 Dual roles of IL-15 in maintaining IL-7RalphalowCCR7- memory CD8+ T cells in humans via recovering the phosphatidylinositol 3-kinase/AKT pathway.
17964972 2007 The expression of interleukin-15 and interleukin-18 by human term placenta is not affected by lipopolysaccharide.
17947730 2007 High interleukin-15 expression characterizes childhood acute lymphoblastic leukemia with involvement of the CNS.
17938255 2008 The opposite effects of IL-15 and IL-21 on CLL B cells correlate with differential activation of the JAK/STAT and ERK1/2 pathways.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17655329 2007 Elucidation of the interleukin-15 binding site on its alpha receptor by NMR.
17635814 Locally produced survival cytokines IL-15 and IL-7 may be associated to the predominance of CD8+ T cells at heart lesions of human chronic Chagas disease cardiomyopathy.
17616399 2007 Molecular screening and association study of IL15 gene polymorphisms in rheumatoid arthritis.
17554368 2007 Polymorphisms in interleukin-15 gene on chromosome 4q31.2 are associated with psoriasis vulgaris in Chinese population.
17537415 2007 Serum IL-16, not IL-15, was elevated in early second trimester of pregnancy in women who subsequently developed preeclampsia.
17363780 2007 Airway epithelial IL-15 transforms monocytes into dendritic cells.
17324400 2007 Inhibition of TGF-beta signaling by IL-15: a new role for IL-15 in the loss of immune homeostasis in celiac disease.
17158609 2007 Interaction of monocytic cells with respiratory syncytial virus results in activation of NF-kappaB and PKC-alpha/beta leading to up-regulation of IL-15 gene expression.
17142786 2006 Familial NK cell deficiency associated with impaired IL-2- and IL-15-dependent survival of lymphocytes.
17110377 2007 Distinct patterns of cytokine regulation of APOBEC3G expression and activity in primary lymphocytes, macrophages, and dendritic cells.
17001647 2006 Docking of human interleukin-15 to its specific receptor alpha chain: correlation between molecular modeling and mutagenesis experimental data.
16791279 2006 Novel IL-15 isoforms generated by alternative splicing are expressed in the intestinal epithelium.
16772281 2006 Ovarian follicular concentration of IL-12, IL-15, IL-18 and p40 subunit of IL-12 and IL-23.
16670327 2006 MyD88-dependent signaling for IL-15 production plays an important role in maintenance of CD8 alpha alpha TCR alpha beta and TCR gamma delta intestinal intraepithelial lymphocytes.
16629787 2006 Confirmation of association of IL-15 with pediatric asthma and comparison of different controls.
16606671 2006 Endogenous factors enhance HIV infection of tissue naive CD4 T cells by stimulating high molecular mass APOBEC3G complex formation.
16507118 2006 Synovial expression of IL-15 in rheumatoid arthritis is not influenced by blockade of tumour necrosis factor.
16482511 2006 Divergent effects of IL-12 and IL-23 on the production of IL-17 by human T cells.
16474399 2006 Interleukin-15 rescues tolerant CD8+ T cells for use in adoptive immunotherapy of established tumors.
16333313 2006 Family based association analysis of the IL2 and IL15 genes in allergic disorders.
16284400 2006 Soluble interleukin-15 receptor alpha (IL-15R alpha)-sushi as a selective and potent agonist of IL-15 action through IL-15R beta/gamma. Hyperagonist IL-15 x IL-15R alpha fusion proteins.
16273100 2005 Interleukin 15 controls the generation of the restricted T cell receptor repertoire of gamma delta intestinal intraepithelial lymphocytes.
16148110 2005 Human T cells constitutively express IL-15 that promotes ex vivo T cell homeostatic proliferation through autocrine/juxtacrine loops.
16136475 2005 Interleukin-15 activates human natural killer cells to clear the intestinal protozoan cryptosporidium.
16109314 2005 Serum interleukin-15 concentration in patients with essential hypertension.
16098919 2005 IL-15 is elevated in serum patients with type 1 diabetes mellitus.
16060678 2005 High-affinity CD25-binding IL-2 mutants potently stimulate persistent T cell growth.
16024007 2005 Beneficial effect of short-term exposure of human NK cells to IL15/IL12 and IL15/IL18 on cell apoptosis and function.
15993713 2005 Coculture of Th cells with interleukin (IL)-7 in the absence of antigenic stimuli induced T-cell anergy reversed by IL-15.
15976176 2005 IL-15 but not IL-2 rapidly induces lethal xenogeneic graft-versus-host disease.
15943034 2005 Interleukin-15 and transforming growth factor alpha are associated with depletion of tumor-associated macrophages in colon cancer.
15778359 2005 IL-15 activates telomerase and minimizes telomere loss and may preserve the replicative life span of memory CD8+ T cells in vitro.
15770395 2005 Possible involvement of the interleukin-15 and interleukin-15 receptor system in a heightened state of lamina propria B cell activation and differentiation in patients with inflammatory bowel disease.
15713701 2005 Central role of interleukin-15 in postovulatory recruitment of peripheral blood CD16(-) natural killer cells into human endometrium.
15710591 2005 AKT plays a role in the survival of the tumor cells of extranodal NK/T-cell lymphoma, nasal type.
15598425 2004 IL-15 alters expression and function of the chemokine receptor CX3CR1 in human NK cells.
15563472 2005 Interleukins 2 and 15 regulate Ets1 expression via ERK1/2 and MNK1 in human natural killer cells.
15557159 2004 Follicular dendritic cells produce IL-15 that enhances germinal center B cell proliferation in membrane-bound form.
15536127 2004 Distinct roles of IL-12 and IL-15 in human natural killer cell activation by dendritic cells from secondary lymphoid organs.
15531573 2004 Association of interleukin-15 protein and interleukin-15 receptor genetic variation with resistance exercise training responses.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15358647 2004 Interleukin-15 enhances cytotoxicity, receptor expression, and expansion of neonatal natural killer cells in long-term culture.
15353479 2005 Dendritic cell-derived IL-2 production is regulated by IL-15 in humans and in mice.
15347678 2004 Interleukin (IL)-15 and IL-2 reciprocally regulate expression of the chemokine receptor CX3CR1 through selective NFAT1- and NFAT2-dependent mechanisms.
15328153 2004 Enhancement of the host immune responses in cutaneous T-cell lymphoma by CpG oligodeoxynucleotides and IL-15.
15225634 2004 Interleukin-15 is able to suppress the increased DNA fragmentation associated with muscle wasting in tumour-bearing rats.
15131572 2004 Multilocus haplotype analyses reveal association between 5 novel IL-15 polymorphisms and asthma.
15039446 2004 Identification of an interleukin-15alpha receptor-binding site on human interleukin-15.
15034035 2004 Monocyte surface-bound IL-15 can function as an activating receptor and participate in reverse signaling.
14984938 2004 Differential expression of interleukins IL-13 and IL-15 in normal ovarian tissue and ovarian carcinomas.
14982947 2004 Interleukin-15 delays human neutrophil apoptosis by intracellular events and not via extracellular factors: role of Mcl-1 and decreased activity of caspase-3 and caspase-8.
14967307 2004 Correlation between interleukin-15 and granzyme B expression and acute lung allograft rejection.
14762166 2004 IL-15 enhances the in vivo antitumor activity of tumor-reactive CD8+ T cells.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14684414 2004 Mature dendritic cells can enhance CD8+ cell noncytotoxic anti-HIV responses: the role of IL-15.
14662842 2003 IL-15 and cognate antigen successfully expand de novo-induced human antigen-specific regulatory CD4+ T cells that require antigen-specific activation for suppression.
14648805 Reduced cumulative incidence of diabetes but not insulitis following administration of chimeric human IL-15-murine IgG2b in NOD mice.
14617758 2003 Resolution of psoriasis upon blockade of IL-15 biological activity in a xenograft mouse model.
14607946 2003 Autocrine/paracrine IL-15 that is required for type I IFN-mediated dendritic cell expression of MHC class I-related chain A and B is impaired in hepatitis C virus infection.
14607929 2003 Human CD94 gene expression: dual promoters differing in responsiveness to IL-2 or IL-15.
14581351 2003 Production of interleukin 15 by human colon cancer cells is associated with induction of mucosal hyperplasia, angiogenesis, and metastasis.
14499665 2003 Interleukin-15 increases myosin accretion in human skeletal myogenic cultures.
12960322 2003 Identification of a novel subpopulation of human cord blood CD34-CD133-CD7-CD45+lineage- cells capable of lymphoid/NK cell differentiation after in vitro exposure to IL-15.
12865812 2003 Interleukin-15 production during liver allograft rejection in humans.
12857602 2003 Role of interleukin-15 and interleukin-18 in the secretion of sIL-6R and sgp130 by human neutrophils.
12847234 2003 IL-15-mediated induction of LFA-1 is a late step required for cytotoxic differentiation of human NK cells from CD34+Lin- bone marrow cells.
12826231 2003 Upregulation of IL-2 but not IL-15 by allorecognition in human mixed lymphocyte culture.
12805064 2003 IL-15 induces antigen-independent expansion and differentiation of human naive CD8+ T cells in vitro.
12759422 2003 IL-21 in synergy with IL-15 or IL-18 enhances IFN-gamma production in human NK and T cells.
12757260 2003 Studies on the production of IL-15 in HIV-infected/AIDS patients.
12747456 2003 Evaluation of p53, bcl-2, and interleukin-15 levels in gingival crevicular fluid of cyclosporin A-treated patients.
12734346 2003 IL-15 promotes the survival of naive and memory phenotype CD8+ T cells.
12623850 2003 Differential STAT3, STAT5, and NF-kappaB activation in human hematopoietic progenitors by endogenous interleukin-15: implications in the expression of functional molecules.
12598649 2003 IL-15 availability conditions homeostasis of peripheral natural killer T cells.
12571184 2003 Increased levels of interleukin-15 in the peritoneal fluid of women with endometriosis: inverse correlation with stage and depth of invasion.
12542496 2003 HIV-1 matrix protein p17 enhances the proliferative activity of natural killer cells and increases their ability to secrete proinflammatory cytokines.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12453470 2002 Interleukin-15 interactions with interleukin-15 receptor complexes: characterization and species specificity.
12421959 2002 CD8 T cell-mediated killing of Cryptococcus neoformans requires granulysin and is dependent on CD4 T cells and IL-15.
12401478 2002 Regulation of lymphoid homeostasis by interleukin-15.
12393488 2003 IL-15 enhances survival and function of HIV-specific CD8+ T cells.
12391205 2002 Systemic administration of IL-15 augments the antigen-specific primary CD8+ T cell response following vaccination with peptide-pulsed dendritic cells.
12379638 2002 Role of interleukin 15 and interleukin 18 in inflammatory response.
12297341 2002 APC-dependent impairment of T cell proliferation in aging: role of CD28- and IL-12/IL-15-mediated signaling.
12244150 2002 IL-21 up-regulates the expression of genes associated with innate immunity and Th1 response.
12237122 2002 IL-15 up-regulates iNOS expression and NO production by gingival epithelial cells.
12165497 2002 Fibroblast-like synoviocytes from rheumatoid arthritis patients express functional IL-15 receptor complex: endogenous IL-15 in autocrine fashion enhances cell proliferation and expression of Bcl-x(L) and Bcl-2.
12147628 2002 Increased IL-15 production of muscle cells in polymyositis and dermatomyositis.
12115611 2002 IFN-gamma-independent synergistic effects of IL-12 and IL-15 induce anti-tumor immune responses in syngeneic mice.
12114302 2002 Expression of IL-15 and IL-15 receptor isoforms in select structures of human fetal brain.
12089714 2002 Cytokine gene polymorphisms and acute human liver graft rejection.
11972069 2002 IL-15 mimics T cell receptor crosslinking in the induction of cellular proliferation, gene expression, and cytotoxicity in CD8+ memory T cells.
11830476 2002 Expression of type 1 (interferon gamma) and type 2 (interleukin-13, interleukin-5) cytokines at distinct stages of natural killer cell differentiation from progenitor cells.
11807773 2002 IL-15 induces type 1 and type 2 CD4+ and CD8+ T cells proliferation but is unable to drive cytokine production in the absence of TCR activation or IL-12 / IL-4 stimulation in vitro.
11746271 2001 Differential expression of interleukin-15, a pro-inflammatory cytokine and T-cell growth factor, and its receptor in human prostate.
11702064 2001 Critical role of IL-15-IL-15R for antigen-presenting cell functions in the innate immune response.
11680634 2001 The cytokine network and interleukin-15 (IL-15) in brain development.
11581322 2001 Interleukin 15 skews monocyte differentiation into dendritic cells with features of Langerhans cells.
11369758 2001 Interleukin-15 prevents mouse mast cell apoptosis through STAT6-mediated Bcl-xL expression.
11287118 2001 Interleukin-15 mediates reciprocal regulation of adipose and muscle mass: a potential role in body weight control.
11168804 2001 Dermal fibroblasts sustain proliferation of activated T cells via membrane-bound interleukin-15 upon long-term stimulation with tumor necrosis factor-alpha.
11134366 2001 Expression profiles of interleukin-15 in early and late gestational human placenta and in pre-eclamptic placenta.
11134140 2000 Progesterone enhances interleukin-15 production in human endometrial stromal cells in vitro.
10869346 2000 The long signal peptide isoform and its alternative processing direct the intracellular trafficking of interleukin-15.
10851076 2000 Altered natural killer cell differentiation in CD34+ progenitors from chronic myeloid leukemia patients.
10784451 2000 Control of homeostasis of CD8+ memory T cells by opposing cytokines.
9405632 1997 Generation of secretable and nonsecretable interleukin 15 isoforms through alternate usage of signal peptides.
9176231 1997 Interleukin-15 signals T84 colonic epithelial cells in the absence of the interleukin-2 receptor beta-chain.
8977197 1997 Regulation of IL-15 secretion via the leader peptide of two IL-15 isoforms.
8932977 1996 Genomic structure and chromosomal localization of the human interleukin 15 gene (IL-15).
8668345 1996 Identification of a novel interleukin-15 (IL-15) transcript isoform generated by alternative splicing in human small cell lung cancer cell lines.
8610139 1996 Interleukin (IL) 15/IL-T production by the adult T-cell leukemia cell line HuT-102 is associated with a human T-cell lymphotrophic virus type I region /IL-15 fusion message that lacks many upstream AUGs that normally attenuates IL-15 mRNA translation.
8568232 1996 Interaction of IL-15 with the shared IL-2 receptor beta and gamma c subunits. The IL-15/beta/gamma c receptor-ligand complex is less stable than the IL-2/beta/gamma c receptor-ligand complex.
8178155 1994 Cloning of a T cell growth factor that interacts with the beta chain of the interleukin-2 receptor.
8026467 1994 Utilization of the beta and gamma chains of the IL-2 receptor by the novel cytokine IL-15.
7759105 1995 Chromosomal assignment and genomic structure of Il15.
7641685 1995 Identification and cloning of a novel IL-15 binding protein that is structurally related to the alpha chain of the IL-2 receptor.
7568001 1995 Tyrosine phosphorylation and activation of STAT5, STAT3, and Janus kinases by interleukins 2 and 15.