Property Summary

NCBI Gene PubMed Count 537
PubMed Score 1774.22
PubTator Score 1872.16

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P35225 O43644 Q4VB52 Q9UDC7 IL-13
Symbols P600
IL-13

Gene

PDB

3BPO   5E4E   1GA3   1IJZ   1IK0   1J9U   3G6D   3ITR   3ITS   3L5W   3L5X   3LB6   4I77   4PS4  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Protein-protein Interaction (7)

Gene RIF (561)

PMID Text
26986948 Data show that single nucleotide polymorphisms (SNPs) rs848 in the interleukin 13 (IL13) gene region is significantly associated with a continuous measure of symptom severity in adult subjects with ever asthma.
26897823 IL-13 may induce mitral valvular fibrosis rheumatic heart disease.
26831416 investigated five SNPs (C-589T and C-33T of IL4, G+2044A of IL13, A+1902G of IL4Ralpha, and A+896G of TLR4) in patients with adult onset asthma to evaluate their role in manifestation and severity of asthma
26693492 genetic polymorphism is associated with autoimmune hepatitis in Brazilian children
26516307 a protective role of mutant alleles G and A in IL-10-1082A/G and IL-13+2044G/A against gliomas.
26474238 IL-13 is a type 2 cytokine that is a key mediator of airway inflammation and remodeling in many inflammatory diseases of the lung, such as asthma. Read More: http://www.atsjournals.org/doi/full/10.1164/rccm.201506-1243OC#.V2bnHdLrtNs
26436920 IL-13 induces miR-142-5p and downregulates miR-130a-3p in macrophages, regulating macrophage profibrogenic gene expression in chronic inflammation.
26418997 rs2158177 polymorphism of the IL-13 gene is associated with asthma in ethnic Han Chinese from Qingdao. No association has been found between polymorphisms of TNF-alpha gene with susceptibility to asthma.
26407210 Our in vitro and in vivo data indicate close cooperation between mechanical and inflammatory stimuli on TF expression and release of TF-positive extracellular vesicles in the lungs, which may contribute to pathophysiology of asthma
26399722 DNA hypomethylation of IL13 gene may be associated with increased risk of allergic rhinitis from house dust mite sensitization
26387812 We show that polymorphisms in IL8 rs1126647 and IL13 rs1800925 are associated with sunitinib-induced toxicities.
26365633 Lack of association between RAD50-IL13 polymorphisms and pediatric asthma susceptibility in Northeastern Han Chinese
26335962 PLD1 activation enhanced binding of ROCK1 to ATF-2 and leads to increased expression of IL-13
26258681 The IL13 haplotype rs1800925T-rs20541C increased the risk of disease progression to late-stage schistosomiasis, whereas haplotype rs1800925C-rs20541A showed a protective role against development of late-stage schistosomiasis.
26246572 IL-13/STAT6 signaling is modulated by Kaposi's sarcoma-associated herpesvirus to promote host cell proliferation and viral pathogenesis.
26192556 Immunostaining and semiquantitative analysis revealed increased presence of IL13 in the pulmonary vasculature of patients with connective tissue disease-associated PAH and Schistosoma-PAH compared with normal control subjects.
26088754 review of IL-4 and IL-13 mast cell immunity and detail of the differences that exist between mouse and human mast cell responses to IL-4 and IL-13 [review]
26073683 description of differential expression and non-canonical regulation of IL-4 and IL-13 in various immune cells [review]
26070934 review of the roles IL-4 and IL-13 play in allergic inflammatory states and the utility of their modulation as potential therapeutic strategies for the treatment of allergic disorders [review]
26046681 Results showed the salivary expression level of IL-4, 10, 13 and IL-1RA were raised in oral squamous cell carcinoma patients and IL-1RA were correlated with poorly differentiated tumors.
26044597 analysis of how expression of Th2 cytokines, especially IL-4 and IL-13, are regulated in Th2 cells [review]
26039103 physiologic doses of interleukin-4 (IL-4) and interleukin-13 (IL-13) have profound anti-lymphangiogenic effects and potently impair LEC survival, proliferation, migration
25976462 PAR-2-mediated IL-13 production by human monocytes may be dependent on the Ca2+/ERK2 signaling pathway.
25973044 IL-4/IL-13 signature is an independent predictor of outcomes in patients with localized clear-cell renal cell carcinoma
25848896 Report altered expression of surfactant protein D in airways of asthmatics and interleukin-13 modulation of surfactant protein D in human models of airway epithelium.
25784274 regulates gene expression in IL-33-activated mast cells and type 2 innate lymphoid cells thus contributing to fibrosis, eosinophilia, and mucous metaplasia
25769912 increased protein levels are associated with increased histone acetylation in childhood allergic asthma
25683991 IL-13 alters the expression of ZO-1, and such alterations in the content and distribution of ZO-1 may be relevant in the pathogenesis of proteinuria in the MCNS model.
25674935 Increased level of IL13 is associated with the development of chronic rhinosinusitis with nasal polyps.
25658755 Genetic association study indicates that the functional IL-13 rs20541 polymorphism may contribute to the risk of hepatocellular carcinoma (HCC) in HBV positive patients and the rs20541 polymorphism is a protective factor for it.
25633855 GM-CSF primes IL-13 production by macrophages via PAR-2.
25628470 IL-13 and its signaling mediators are novel markers of cutaneous T-cell lymphoma malignancy and potential therapeutic targets for intervention.
25502839 The results of this meta-analysis suggest that IL13-1112C/T and +2044A/G polymorphisms contribute to the development of pediatric asthma.
25453333 The results of this study suggest that these proteins play important roles in pulmonary inflammatory reactions elicited against etiological viral agents.
25389033 IL-13 confers epithelial cell responsiveness to NGF by regulating NTRK1 levels by a transcriptional and epigenetic mechanism and that this process likely contributes to allergic inflammation.
25172500 Although basophils were recruited into liver granulomas, they appeared to be dispensable as a source of IL-4/IL-13 both for differentiation of Th2 cells and for prevention of weight loss and mortality.
25065568 These in vitro data imply that IL-13-treated skin equivalent model exhibited atopic dermatitis-like features and that IL-13 may have a role in basement membrane defects.
24990692 IL-13 G+2044A polymorphism might not contribute to the susceptibility associated with a risk of chronic obstructive pulmonary disease. [meta-analysis]
24966400 IL-13 interacts with hyper-radiosensitive cells though receptor IL-13Ralpha2 and induces upregulation of iNOS and activation of one or more furin-like proprotein convertases.
24920818 HIV-1 gp120 induces release of IL-13 in CD4+ T cells
24886277 serum level not associated with pulmonary arterial hypertension in schistosomiasis
24879793 endogenously expressed IL-13Ralpha2 does not activate any unique IL-13-mediated gene expression patterns, confirming its role as a decoy receptor for IL-13 signaling.
24848505 There is an interaction between IL-13 (rs20541) and delivery mode with respect to the subsequent risk of atopic dermatitis in infancy.
24833143 Patients with lymph node metastasis, lymphatic invasion, vascular invasion, distant metastases or advanced stage of disease had significantly lower serum IL-13 levels.
24822215 Fibrocytes studied were generated in vitro from PBMCs by culturing in the presence of platelet derived growth factors and stimulated by IL-33. Fibrocytes constitutively expressed IL-13 and IL-5, which was augmented by stimulation with IL-33.
24808368 Intravenous immunoglobulin treatment in humans suppresses dendritic cell function via stimulation of IL-4 and IL-13 production.
24564787 Lack of association between the IL-13 C-1112T, G2044A polymorphisms and Graves' disease risk: evidence from a meta-analysis.
24510479 modulates epithelial junction proteins, thereby contributing to the leaky epithelial barrier
24447084 Allergen-specific IL-4- and IL-13-producing T cells were only detected in HDM-allergic asthmatic children (not in patients with non-allergic asthma). Their numbers correlated with clinical severity of allergic rhinitis.
24447082 11beta-HSD2 expression was decreased in allergic nasal mucosa. In cultured epithelial cells treated with IL-4, IL-5, IL-13, and IL-17A, 11beta-HSD1 expression and activity increased in parallel with the expression levels of CYP11B1 and cortisol
24363163 Inhibition of GATA3 activity or blockade of GATA3 expression may attenuate the interleukin-13 mediated asthma phenotypes.
24338253 After allergens stimulation, CD4T cells showed an increase of IL-13 and IL-17 production.
24286397 The polymorphism of the IL-13 gene is associated with an increased risk of COPD in southern Chinese Han population. Plasma IL-13 levels were found elevated in patients with COPD.
24280725 Our results showed that IL-4 or IL-13 acted on differentiating keratinocytes in vitro at early stages to attenuate the gene expression.
24105413 IL-13 is synthesized and released by skeletal muscle through a mechanism involving let-7, and this effect is attenuated in skeletal muscle from insulin-resistant T2 Diabetes mellitus patients.
24053708 IL-13 A2044G and RANTES G-28C are significantly associated with childhood asthma. IL-13 A2044G A/A and RANTES G-28C G/G have a significant and combined effect on the development of asthma.
24001799 We demonstrated an increased proportion of IL-13/IL-22-coproducing T cells with skin-homing properties in the circulation of patients with atopic dermatitis.
23996716 IL-13 gene polymorphisms and their association with atopic asthma and rhinitis in Pakistani patients.
23893513 The role of IL-13 in driving fibrosis in systemic sclerosis and chronic inflammation. [Review]
23874547 This meta-analysis suggests IL-13 -1112 C/T promoter polymorphism is associated with the risk of COPD in Arabians.
23865080 the -1111T mutant allele are associated with asthma and the 4257A mutant alleles are associated with elevated IL-13 production.
23841068 results from this meta-analysis suggested that IL-13 +1923C/T polymorphism was a risk factor of asthma.
23815671 The interaction term [IL13 (rs20541) x STAT6 (rs1059513)] was statistically significant in both studies.
23810766 Our data demonstrate that IL-33 plays a critical role in the rapid induction of airway contraction by stimulating the prompt expansion of IL-13-producing type 2 innate lymphoid cells, whereas IL-25-induced responses are slower and less potent.
23754348 Higher levels of IL-13 in cord blood may be a predictor of future development of allergic sensitization
23713409 The dynamics of STIM1 aggregation and SOCE after exposure to TNF-alpha or IL-13 in ASM cells.
23682108 IL-13 potentiates airway remodelling through a mechanism involving collagen type I expression, TGF-beta1 and MMP-2
23666277 The association of asthma with variation near RAD50/IL13, first discovered in individuals of European ancestry, replicates in individuals of African ancestry.
23663500 the genotype "TC" of rs20541 in IL-13 gene showed an increased risk of glioblastoma in over-dominant model (OR = 2.00; 95% CI, 1.13-3.54, p = 0.015)
23617596 We found an association between psoriasis and a single nucleotide polymorphism of the gene encoding IL-13 in Chinese Ugyur patients.
23614810 associated with uterine fibroids in African American women living in the Detroit, Michigan area
23549736 The rs1800925 T allele of the IL-13 gene is associated with worse pulmonary function in patients with Idiopathic pulmonary fibrosis.
23545317 IL-13 SNP rs20541 exhibited increased AR risk in Asians.
23521898 haplotypes within the IL-13 promoter at -7402 T/G and -4729G/A may modulate severe malarial anemia pathogenesis.
23510983 Data suggest that signal transduction between two cytokines, IL-13 and IL-6, and their respective receptors, IL13R and IL6R, results in rapid phosphorylation of two STAT transcription factors, STAT3 and STAT6, in pancreatic beta-cells.
23437086 This meta-analysis suggested that the IL13 -1112C/T and +2044A/G polymorphisms were risk factors for asthma.
23395224 An meta-analysis suggests that the IL13 rs20541 polymorphism may be a genetic predictor for glioma.
23383108 HIV-1 gp120 induces release of IL-13 in CD4+ T cells
23382814 IL-13 genetic variants showed significant adverse effects on asthma phenotypes among children. The results also suggested that asthma pathogenesis might be mediated by household carpet use.
23376457 Data suggest that the single nucleotide polymorphisms in IL-13/IL-13R genes do not have an impact on the risk of developing endemic PF in Tunisian population.
23351078 These data show that IL-4 and IL-13 decrease kinin receptors in a STAT6-dependent mechanism, which can be one important mechanism by which these cytokines exert their anti-inflammatory effects and impair bone resorption
23333326 these data suggests a potential role for 15d-PGJ2 in regulating IL-13 expression in activated T cells.
23317483 results confirmed the significant role of -1112 C/T IL-13 gene polymorphism in the pathogenesis of atopic dermatitis
23300643 in fibrotic intestinal muscle of Crohn's patients, the IL-13 pathway is stimulated
23249391 TGF-beta decreases baseline and IL-13-stimulated mucin production by primary human bronchial epithelial cells.
23246181 IL13 rs20541 polymorphism contributes to susceptibility to cancer, especially for glioma; and the IL13 rs1800925 polymorphism may be associated with glioma risk.
23223131 We observed large numbers of CD8(+) T cells producing IL-13, IFN-gamma, and IL-22 in atopic dermatitis and psoriasis.
23222300 Changes in tumor proliferation, survival, and metastatic capability have all been ascribed to IL-4 and/or IL-13 action.
23184931 macrophage interleukin-13 receptor has a role in foam cell formation through alphaMbeta2 integrin interference
23171465 IL13 rs20541 A allele [assuming recessive model; odds ratio (OR) = 3.38, 95% CI: (1.63-7.00)] showed association with development of non-atopic hand eczema.
23108822 there is no association between IL-13 gene polymorphisms (at position -1055C/T and +2044GI A) and susceptibility of the patients to squamous cell carcinoma of head and neck.
23070918 A meta-analysis indicates that IL-13 C-1112T and G+2044A polymorphisms could be proposed as asthma susceptible SNPs.
23045480 IL-13 induces vitamin D-dependent hCAP18/LL-37 expression in bronchial epithelial cells most likely by increasing CYP27B1.
22981205 findings indicate an inhibitory role of E2F6 in the regulation of IL-13 and allergy
22952702 Leukotriene D4 and interleukin-13 cooperate to increase the release of eotaxin-3 by airway epithelial cells
22846750 Children with GA or AA at IL13(12044) are at increased risk for allergic rhinitis when exposed to mold in the home during the first year of life.
22750299 combined results based on all studies showed that IL-13 SNP rs1800925 was not associated with increased allergic rhinitis risk
22749024 Giant cell arteritis is more frequent in carriers of the IL-13 rs20541 (R130Q) polymorphism. No significant difference was found in polymyalgia rheumatica and rheumatoid arthritis patients compared with controls.
22741617 data showed that the IL-8 -251 T/A and IL-13 -1112 C/T polymorphisms might be associated with the inflammatory bowel disease and colorectal cancer occurrence
22698804 Concentrations of IL-4, IL-13 and IFN-gamma were measured in serum samples of 88 subjects with asthma.
22686311 The association between the IL-13 -1055T allele and elevated total IgE levels confirms the role of a genetic background for total IgE regulation
22661199 Interleukin-13-induced activation of signal transducer and activator of transcription 6 is mediated by an activation of Janus kinase 1 in cultured human bronchial smooth muscle cells.
22574126 The two functional variants in IL13 are protective against high S. mansoni egg counts
22573806 TGF-beta1 can augment eosinophilic inflammation by interfering with IL-13's negative feedback autoregulatory loop under MEK/ERK-dependent conditions
22534877 Genome-wide significant association was found for rs20541 and rs998592, thus establishing IL-13 and KIAA0350/CLEC16A as susceptibility loci for alopecia areata. IL-13 and KIAA0350/CLEC16A are also susceptibility loci for other autoimmune diseases.
22521249 The enhancement of protease activity through increased KLK7 expression by the TH2 cytokines IL-4 and IL-13 might be an important factor for mechanical and chemical epidermal barrier dysfunction in patients with atopic dermatitis.
22506826 In our pilot study, we discovered significant changes in methylation patterns of genes IL-7, IL-13, IL-17C and TYK2 between henodialysis patients and healthy subjects
22471460 Polymorphisms of IL-13 is not associated with Non-Small-Cell Lung Carcinoma.
22441356 Expression of IL-4, IL-4R, and IL-13R are involved in the process of local metastases in colorectal cancer, while IL-13 expression has an impact on survival.
22432974 genetic polymorphism is associated with elevation in cord blood IgE
22407982 IL-13Ralpha2 is a high affinity receptor for IL-13 binding: implications in the understanding of the role of IL-13-R110Q in the disease state.
22376040 In Korean asthmatic children, increased serum IgE level was a multi-locus interaction between IL-4Ralpha, IL-13, IL-13Ralpha1, CD14, and CTLA4 polymorphisms. The combination of CTLA4/IL-13 and IL-13/IL-13Ralpha1 polymorphisms showed strong synergistic effects.
22370092 results demonstrate that oxidant signaling activates IL-13 gene transcription in lung smooth muscle cells and that this signaling mechanism regulates cell growth
22355542 These studies indicate that IL-13 induces AD and atopic march via a TSLP dependent mechanism.
22325047 A polymorphic variant of human IL-13, R130Q,is more active than wildtype IL-13 in inducing hydrocortisone-dependent IgE synthesis.
22317767 Authors observed that IL-13 C-1055T and Arg130Gln polymorphisms could decrease the risk of renal cell carcinoma.
22287592 Findings suggest that TGFbeta and IL-13 play a synergistic role in the pathogenesis of fistulae in Crohn's disease.
22236719 Report no association among environmental tobacco smoke exposure, asthma, and Il-13 polymorphisms in a population of children from Northern Mexico.
22229804 all enveloped viruses, but none of the bacteria, blocked Th2 (IL-13) production by cord CD4(+) cells
22226971 Chromatin Conformation Capture (3C) demonstrated the formation of specific ligation products containing spliced IL-4 and IL-13 DNA sequences in human T(H)2 polarised HuT-78 cells.
22222605 genetic association studies: Data suggest that two single nucleotide polymorphisms in interleukin-13 (rs20541; rs1800925) are associated with adult-onset asthma and may be used as risk factors. [META-ANALYSIS]
22204768 This review focuses on the role of IL-13 on airway hyperresponsiveness and corticosteroids resistant asthma both preclinically and clinically.
22170601 Polymorphisms of IL-4, IL-4R and IL-13 genes predicted Chinese bladder cancer risk in 817 bladder cancer and 1,141 controls, were examined.
22166239 The presented study suggested the possibility of a connection between the IL-13 gene polymorphism (-1112 C/T) and colorectal cancer risk in the Polish population.
22154382 dampens human airway epithelial innate immunity through induction of IL-1 receptor-associated kinase M
22123380 Findings suggest that the IL-13 -1111C>T and IL-17A -737C>T gene sequence variations might have a role in the development of aspirin-exacerbated respiratory disease.
22092872 IL-4 and IL-13 prime the migrational response of HPC to SDF-1alpha by enhancing the incorporation of CXCR4 into lipid rafts.
22087298 there was no significant association of the IL13 and IL4RA polymorphisms with mite-sensitized persistent allergic rhinitis
22053598 Five SNPs (rs1800469, rs2241712, rs2070874, rs20541 and rs1800925) in TGF-beta1, IL-4 and IL-13 were genotyped using the MassArray SNP genotyping system.
22045834 Data showed that polymorphisms in IL4, IL13, and their receptors do not play a role in SSc and do not influence the expression of their corresponding transcript in peripheral blood cells.
22039304 c-Myb critically regulates IL-13 expression via direct binding to the conserved GATA-3 response element
22039015 GATA-binding protein 3 (Gata3) is essentially required for II13 gene expression in super T(h)1 cells.
22023794 This study suggests that the minor genotype of IL13 SNP rs20541 and the CA haplotype are significantly positively associated with the risk of rhinoconjunctivitis.
22013915 Our findings suggest that the IL13 SNP rs1800925 is significantly associated with eczema in Japanese young adult women. We could not find evidence for an interaction between SNP rs1800925 and smoking with regard to eczema.
21920770 The role of the pro-fibrotic type 2 cytokine IL-13 and its regulation appear to be important in the pathogenesis of Systemic sclerosis.
21913997 the combination of rs3091307 GG/ rs2265753 GG (IL-13/IL-13Ralpha1) conveyed a significantly higher risk for developing atopic dermatitis
21762457 the IL13 C-1112T and G+2044A polymorphisms predispose to asthma (Meta-Analysis)
21677024 Study provides some evidence for the involvement of IL-13 in the modulation of neuronal integrity and synaptic function in patients with multiple sclerosis.
21616524 Let-7 microRNAs inhibit IL-13 expression
21613309 study concludes that IL13 gene polymorphism is associated with increased susceptibility to psoriatic arthritis in psoriasis patients
21576506 progression of skin fibrosis in IL-13-induced atopic dermatitis occurs via TSLP/TSLPR-dependent but IL-13-independent novel mechanisms by promoting fibrocyte functions
21489615 Single nucleotide polymorphisms of CD14, IL-13 and IL-4 receptor are associated with hexamethylene diisocyanate asthma.
21478113 IL-13 was detectable in 15% patients with Down syndrome and in 15.2% healthy subjects, respectively
21430433 IL-13 Q110/Q110 increases, at least in part, allergic inflammation and the propensity for airway remodeling, thus resulting in low lung function.
21426411 Significant interactions between the 2282del4 FLG mutation and the CT genotype for IL-13 or GG genotype for IL-10 and a higher risk for developing atopic dermatitis were demonstrated.
21425907 serum IL-13 can be used as a marker in atopic diseases and to differentiate between atopic and non-atopic asthma.
21325281 Epigenetic regulation of the IL-13-induced human eotaxin-3 gene by CREB-binding protein-mediated histone 3 acetylation.
21289305 Eosinophils deficient in IL-13 are unable to rescue airway hyperresponsiveness, T cell recruitment to the lungs, and T helper type (Th)2 cytokine/chemokine production in transgenic mice.
21275604 results show that SPDEF plays a critical role in regulating a transcriptional network mediating IL-13-induced MUC5AC synthesis dependent on STAT6.
21239604 an allergic airway milieu (e.g., IL-13) increases MUC18 expression, which may contribute to increased bacterial infection/colonization in asthma and other lung diseases
21236478 results suggest that therapies inhibiting IL-13 production could have adverse side effects by increasing IL-17A production
21235536 Functional polymorphisms in the genes encoding the Th2 cytokines Il-5, IL-6, and IL-13, are associated differently with the development and prognosis of autoimmune thyroid disease from each other.
21198753 There is an increased production of IL-13 by the T cells of aggressive periodontitis patients with the IL-4 genotype
21191416 Expression of matrix metalloproteinase-13 is controlled by IL-13 via PI3K/Akt3 and PKC-delta in normal human dermal fibroblasts.
21191414 T(h)2 cytokines, IL-4 and IL-13, modulate Toll-like receptor 9 (TLR-9)- and herpes simplex virus-induced plasmacytoid dendritic cell phenotype and enhance the ability of these cells to induce allogeneic T-cell responses
21097505 The interleukin 13 (IL-13) pathway in human macrophages is modulated by microRNA-155 via direct targeting of interleukin 13 receptor alpha1 (IL13Ralpha1).
21076368 IL-13 drives PBEC(N) toward an asthmatic phenotype and worsens the phenotype in pediatric asthmatic bronchial epithelial cells by reducing ciliated cell numbers and increasing goblet cells.
21071541 Observational study of gene-disease association. (HuGE Navigator)
21067601 These observations suggest that in disease states with an overexpression of IL-13, there would be some deficiency in mature SP-C and SP-D.
21061265 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20975284 A common genetic variation in the IL13 gene at the levels of both single single nucleotide polymorphisms and haplotypes was associated with eczema.
20975284 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20942272 Observational study of gene-disease association. (HuGE Navigator)
20861864 Polymorphisms rs7719175 and rs1800925 in IL-13 promoter have a synergistic role in the control of infection levels caused by S. haematobium.
20811626 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20802378 Observational study of genetic testing. (HuGE Navigator)
20800603 Observational study of gene-disease association. (HuGE Navigator)
20714168 Findings in this study suggest that adiponectin, IL-12p70, and IL-13 may play a role in the pathogenesis of multiple sclerosis.
20703737 Observational study of gene-disease association. (HuGE Navigator)
20652946 IL-13 enhances the expression of GPIIb in tumor cell lines through a mechanism dependent on the transcription factor STAT6 that is able to bind the GPIIb gene promoter and upregulates the promoter activity.
20644561 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20603037 Observational study of gene-disease association. (HuGE Navigator)
20589076 In this study, we confirm that the levels of both IL10 and IL13 mRNA in CD4+ T cells and of serum IL10 and IL13 proteins are increased in SLE patients.
20572918 IL-13 -1112 CC genotype appears to increase the risk of developing aggressive periodontitis in Taiwanese subjects
20572918 Observational study of gene-disease association. (HuGE Navigator)
20568250 Observational study of gene-disease association. (HuGE Navigator)
20543112 In human esophagus during eosinophilic esophagitis (EE), IL-13 induces notable changes in esophageal transcripts that overlap with the human EE esophageal transcriptome.
20539013 goblet cells formed in response to IL-13 treatment are in part or wholly derived from progenitors that express the ciliated cell marker, FOXJ1
20536507 Observational study of gene-disease association. (HuGE Navigator)
20530519 Observational study of gene-disease association. (HuGE Navigator)
20503287 Observational study of gene-disease association. (HuGE Navigator)
20485362 Observational study of gene-disease association. (HuGE Navigator)
20484924 IL13 polymorphisms were associated with asthma and rhinitis without clinical asthma
20484924 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20444155 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20418295 Observational study of gene-disease association. (HuGE Navigator)
20418110 Observational study of gene-disease association. (HuGE Navigator)
20406594 increased levels in seasonal allergic rhinitis patients as compared to nonallergic rhinitis
20403914 Observational study of gene-disease association. (HuGE Navigator)
20403202 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20395963 Observational study of gene-disease association. (HuGE Navigator)
20394509 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20368097 GATA3-NFAT1 complex may play an important role in the regulation of IL-13 transcription in human T cells.
20358028 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20332709 The interaction of 6-locus from the 5 interleukin genes might confer higher risk for graves'disease and Graves'ophthalmopathy than single risk allele.
20332709 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20306654 Studies suggest that IL-13 is a key cytokine with critical role in the immunopathogenesis of bronchial asthma.
20299965 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20236697 Our data indicate that epithelial cells express TSLPR and that TSLP induces bronchial epithelial cell proliferation and increases injury repair through IL-13 production.
20224668 Observational study of gene-disease association. (HuGE Navigator)
20219689 Observational study of gene-disease association. (HuGE Navigator)
20208004 These results establish that the epithelial response in eosinophilic esophagitis involves a cooperative interaction between IL-13 and expression of epidermal differentiation complex genes.
20207250 Observational study of gene-disease association. (HuGE Navigator)
20198887 Observational study of gene-disease association. (HuGE Navigator)
20194818 higher prenatal stress was associated with increased IL-13 after dust mite stimulation and reduced phytohemagglutinin-induced Interferon-gamma in cord blood mononuclear cells
20177070 MLCK activation increases paracellular flux of uncharged macromolecules and also triggers IL-13 expression, claudin-2 synthesis, and increased paracellular cation flux.
20159242 Multiple single nucleotide polymorphisms in the RAD50-IL13 region on chromosome 5q31.1 were associated with asthma
20159242 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20140262 Observational study of gene-disease association. (HuGE Navigator)
20107485 IL-13 upregulates MOR in activated Langerhans cells in Sezary syndrome
20093796 both IL-13 and IL-4 caused a significant increase in the levels of phosphorylated STAT1 in bronchial smooth muscle cells
20085599 IL13 SNPs showed no association with wheeze in the last year or with eczema. However, there were strong associations of IL13 variants with more severe asthma or allergic rhinitis symptoms, positive skin reactions and increased levels of total serum IgE.
20085599 Observational study of gene-disease association. (HuGE Navigator)
20081054 Interleukin-13 mucous metaplasia is also associated with increased levels of rhinoviral infection.
20051514 our results identify NF45 and NF90 as novel regulators of HS4-dependent human IL13 transcription in response to T cell activation
19995275 Observational study of gene-disease association. (HuGE Navigator)
19968504 The overexpression of IL-13 as a potent immunosuppressive cytokine was found in patients with bladder cancer and may be playing a role as an anti-inflammatory mediator in carcinoma of bladder
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19933216 Meta-analysis of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19910508 IL-13 is involved in conjunctival fibrosis in ocular mucous membrane pemphigoid
19862939 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19840389 Observational study of gene-disease association. (HuGE Navigator)
19796199 IL13 single nucleotide polymorphisms may contribute to atopy and asthma
19789190 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19773451 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
19772762 the association of IL-13 gene polymorphisms with asthma
19772762 Observational study of gene-disease association. (HuGE Navigator)
19759281 IFN-lambda1-treated pDC display a marked difference in their ability to stimulate production of the signature cytokines IL-13, IFN-gamma, and IL-10 in a MLR
19739097 SUMF2 interacted with IL-13 and inhibited IL-13 secretion in bronchial smooth muscle cells and lymphocytes, which was independent of IL-13 glycosylation
19729601 Observational study of gene-disease association. (HuGE Navigator)
19726720 This study identifies the E-cadherin/catenin complex as a discriminative, partly polyamine-regulated feature of IL-4/IL-13-exposed alternatively activated macrophages
19706623 IL13-1512A>C is a functional polymorphism that enhances IL13 expression by creating a binding site for the transcription factor Oct-1.
19706316 differential modulation of in vitro model of R5-HIV-1 transfer from macrophages towards T cells was demonstrated in vitro according to the relative secretion of IL-4/IL-13 at paracrine level.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19674346 There was a statistically significant association between the IL-13 Arg144Gln polymorphism and risk of recurrent wheeze in children and a statistically significant interaction between this polymorphism and exposure to tobacco smoke during pregnancy.
19674346 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19659863 peptidoglycan from S. aureus can induce LL37 and VEGF expression in keratinocytes, and this VEGF production can be amplified by subsequent IL-13 overproduction
19654941 IL-13 and its receptors may contribute to the pathogenesis of fibrosis in idiopathic interstitial pneumonia and appear to be related to the severity of the disease.
19635933 Findings suggest an important role for IL-13 regulation of activin A in asthma pathogenesis.
19625176 Observational study of gene-disease association. (HuGE Navigator)
19602238 IL-13 expression is increased in peripheral blood-derived T cells in asthma and that asthmatic serum up-regulates IL-13 release from healthy peripheral blood mononuclear cells.
19586918 the D1 domain of IL-13Ralpha1 acts as an affinity converter, through direct cytokine interactions, that allows the shared receptor to respond differentially to IL-4 and IL-13.
19578876 Observational study of gene-disease association. (HuGE Navigator)
19575932 There was a significant correlation between the polymorphisms of +33C/T sites of IL-4 and +1923C/T sites of IL-13 gene and susceptibility to asthma and increase of the total serum IgE.
19573080 Observational study of gene-disease association. (HuGE Navigator)
19559392 Observational study of gene-disease association. (HuGE Navigator)
19555572 Observational study of gene-disease association. (HuGE Navigator)
19554022 IL13 polymorphisms associate most strongly with psoriatic arhtritis and smoking may modulate this effect
19554022 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19536153 Observational study of gene-disease association. (HuGE Navigator)
19527514 Observational study of gene-disease association. (HuGE Navigator)
19515749 Observational study of gene-disease association. (HuGE Navigator)
19507063 papillary thyroid carcinomas had more genetic copy number alteration than benign nodules (P < 0.001)
19505916 Observational study of gene-disease association. (HuGE Navigator)
19487697 Phospholipase D1 acts as an important regulator in house dust mite allergen Der f 2-induced expression and production of IL-13 through activation of activating transcription factor-2 activation in human bronchial epithelial cells.
19479237 Observational study of gene-disease association. (HuGE Navigator)
19470259 PPAR-gamma and IL-13 might participate in the pathogenesis of acute ITP.
19420105 Observational study of gene-disease association. (HuGE Navigator)
19417211 Epstein-Barr virus Zta protein-induced IL-13 production facilitates B-cell proliferation and may contribute to the pathogenesis of EBV-associated lymphoproliferative disorders
19333920 Dysregulated IL-13 production by effector CD8+ T cells is important in the pathogenesis of systemic sclerosis
19332998 IL-13/IL-4 and TLR-10 might be involved in the genetics of preterm births.
19326508 gene polymorphism association with allergies and drug responsiveness (inhaled steroids, leukotriene inhibitors)in hispanics and asians, respectively
19264973 Observational study of gene-disease association. (HuGE Navigator)
19263529 Observational study of gene-disease association. (HuGE Navigator)
19262574 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19254294 The role of IL13 polymorphism on risk of asthma and allergy, and possibly hay fever, reported for the first time.
19254294 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19251840 These novel findings identify a Th2 cytokine-driven homeostatic feedback mechanism in airway smooth muscle that enhances its responsiveness to endogenous glucocorticoids by upregulating 11beta-HSD1 activity.
19247692 Observational study of gene-disease association. (HuGE Navigator)
19231232 IL-13 activates NF-kappaB in human bronchial smooth muscle cells
19225544 Observational study of gene-disease association. (HuGE Navigator)
19222422 Observational study of gene-disease association. (HuGE Navigator)
19220774 These findings suggest that IL13 variants play a major role not only in non-cognate but also in allergen specific IgE synthesis.
19220774 Observational study of gene-disease association. (HuGE Navigator)
19192232 IL-13, rather than IL-4, may play a pro-inflammatory role during acute severe asthma, whereas IFN-gamma responses were associated with recovery from acute severe asthma.
19190772 The polymorphisms of IFN-gamma , IL-13 and IL-4 do not by themselves confer resistance or susceptibility to Schistosoma mansoni reinfection, but these genotypes allow the resistant phenotype to be developed and expressed upon suitable immune exposure.
19190772 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19178408 The -1112C/T IL-13 gene polymorphism and the resulting 'hypertranscription' may predispose for the development of systemic mastocytosis.
19178408 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19169254 Expanded catalog of genetic loci implicated in psoriasis susceptibility.
19141347 increased expression in eosinophils infiltrating the esophageal mucosa of patients with eosinophilic esophagitis
19131662 Meta-analysis of gene-disease association. (HuGE Navigator)
19131452 Observational study of gene-disease association. (HuGE Navigator)
19122650 augmented production of HA and the decreased E-cadherin expression by keratinocytes stimulated with IL-4/IL-13 or IFN-gamma cause spongiosis in acute eczema
19116009 Pre-treatment with IL-4 and IL-13, but not IFN-gamma, induced desensitization of the human airway smooth muscle cells to IL-13 as measured by eotaxin secretion and calcium transients to histamine.
19109239 IL-4 activates signaling pathways through type I IL-4Rs qualitatively differently from IL-13, which cooperate to induce optimal gene expression.
19074885 Observational study of gene-disease association. (HuGE Navigator)
19019335 Observational study of gene-disease association. (HuGE Navigator)
19011907 Observational study of gene-disease association. (HuGE Navigator)
19005922 Coincubation with IL-9 or IL-13 was protective against this corticosteroid-induced apoptosis by up-regulation of Bcl-2
18989750 The presence of CCA haplotype of IL13 gene may be associated with susceptibility of Iranian women to breast cancer.
18989750 Observational study of gene-disease association. (HuGE Navigator)
18974840 Observational study of gene-disease association. (HuGE Navigator)
18949100 Observational study of gene-disease association. (HuGE Navigator)
18941246 Study of pathways engaged in transgenic model of thymic stromal lymphopoietin-driven airway inflammation demonstrates that simultaneous blockade of interleukin (IL)-13 and IL-4 can reverse established asthma-like chronic airway disease.
18931892 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18931077 IL-13 promoter represents a dually active promoter element responsive to NF-kappaB and NFAT after stimulation by HTLV-1 oncoprotein Tax.
18927306 Observational study of gene-disease association. (HuGE Navigator)
18849614 The IL13 single nucleotide polymorphisms under study were associated with specific allergy to olive pollen: the IL13 C-1112T polymorphism as a protective factor and the IL13 R130Q polymorphism as a risk factor.
18849614 Observational study of gene-disease association. (HuGE Navigator)
18818748 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18815020 IL13+2044G-->A is significantly associated with a reduced lung function in Korean children and adolescents.
18815020 Observational study of gene-disease association. (HuGE Navigator)
18712166 Alterations of MMP-2 and -9 expression may play a role in eosinophilic chronic rhinosinusitis, but the association with IL-5 and IL-13 remains unclear
18699941 Our findings do not support a role for IL-13 in COPD.
18691306 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18688040 Interleukin-13 augments bronchial smooth muscle contractility with an up-regulation of RhoA protein.
18676870 Observational study of gene-disease association. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18674658 Observational study of gene-disease association. (HuGE Navigator)
18633131 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18625055 results indicate that common variants of the IL-4/IL-13 pathway do not significantly contribute to rheumatoid arthritis susceptibility and radiological severity.
18625055 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18551035 IL-13 -1112C/T polymorphism and the haplotype of IL-13 polymorphisms seem to be associated with leukotriene receptor antagonist drug responsiveness.
18551035 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18545091 Observational study of gene-disease association. (HuGE Navigator)
18506597 The results of this study reveal that although +2044 (G/A) and -1055 (C/T) single nucleotide polymorphisms in IL-13 are implicated in some pulmonary processes, they do not confer susceptibility to lung cancer in Iranian population.
18506597 Observational study of gene-disease association. (HuGE Navigator)
18497474 IL-13 attenuates EC viability by inducing apoptosis, and STAT6 plays pivotal roles on IL-13- and IL-4-induced apoptosis in ECs.
18441098 activation of the TRPM8 variant in human lung epithelial cells leads to increased expression of IL-1alpha, -1beta, -4, -6, -8, and -13, granulocyte-macrophage colony-stimulating factor (GM-CSF), and TNF-alpha.
18441092 IL-13 induces potentiation of Ca(2+) responses to contractile agonists by affecting mechanisms downstream of receptors
18418228 in patients undergoing percutaneous coronary angioplasty, a correlation was present between the severity of the coronary lesions and serum IL-13 levels
18417506 in children, IL13 minor alleles of rs1295685 and rs20541 were significantly associated with elevated IgE levels
18417506 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18410779 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18410415 IL13 was not associated with childhood eczema. A SNP in GATA3 is associated with atopic eczema. This finding highlights the importance of GATA3 as an immune-modulating gene in atopic eczema.
18410415 Observational study of gene-disease association. (HuGE Navigator)
18403443 Human bronchial smooth muscle cells contain functional BK(Ca) channels whose activity is rapidly potentiated by the cytokine, IL-4, but not by IL-13.
18395486 This study demonstrates an interplay between TGFbeta1, IL-13 and CCL2 in idiopathic pulmonary fibrosis with a usual interstitial pneumonia histological pathology, where these three mediators feedback on each other, promoting the fibrotic response.
18385759 S100/A11 is significantly downregulated in the presence of IL-4 and IL-13.
18348727 IL-13 may contribute to subepithelial fibrosis in asthma by stimulating biologically significant TGF-beta2 secretion from the airway epithelium.
18341619 There appears to be a synergistic effect between the TNF-alpha promoter polymorphism and an IL-13 coding region polymorphism in terms of asthma susceptibility and BHR in Korean children with asthma.
18341619 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18312531 A statistically significant correlation was determined between serum IL-13 levels of infants and number of wheezing episodes. High serum IL-13 levels and a positive history of allergy may have important roles in the recurrence of acute bronchiolitis.
18296848 IL-13 has anti-angiogenic activity as a result of activation of JAK2 and subsequent activation of STAT6.
18296657 Three SNPs and the AT repeat length in CTLA-4 conferred susceptibility to childhood Graves' Disease, whereas IL-13 polymorphisms did not. No association was found between CTLA-4 and IL-13 with Graves' Ophthalmopathy.
18273035 Observational study of gene-disease association. (HuGE Navigator)
18263811 combined polymorphisms in the IL-13/IL-4R signaling pathway were associated with SJS/TEN with ocular surface complications.
18263811 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18251702 IL-4 and IL-13 induced osteoprotegerin(OPG) expression through activation of STAT6 in endothelial cells, and HUVEC-derived OPG is an IL-4/IL-13-induced inhibitor of osteoclastic resorption
18243827 IL-13 could be implicated in the different outcome of H. pylori infection.
18243101 Molecular and structural basis of cytokine receptor pleiotropy in the interleukin-4/13 system are eported.
18204280 IL-13 and IL-4 potently induce fibroblast growth factor 2-primed bronchial smooth muscle cell (BSMC) proliferation; could have a potential role in BSMC hyperplasia.
18186920 This is the first report that shows a combined effect of in utero exposure to smoking and IL13 on asthma phenotypes in childhood.
18186920 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18073124 Pathogenesis of eosinophilic esophagitis is mediated by an IL-13-stimulated keratinocyte-derived transcriptome.
18056382 Observational study of gene-disease association. (HuGE Navigator)
18037162 Gene-gene interaction between GATA3 and IL13 polymorphisms can influence the risk of childhood rhinitis.
18037162 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18028994 Glucocorticoid receptor beta is able to act as a transcriptional repressor of cytokine genes, IL5 and IL13 and mediates its function through the recruitment of histone deacetylase complexes.
18006935 Observational study of gene-disease association. (HuGE Navigator)
17911623 IL-13-overexpressing transgenic mice have a reduced survival time and higher pulmonary fungal load during Cryptococcus neoformans infection.
17883727 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17868461 Plasma concentrations of IL-13 show associations with increasing severity of chronic obstructive lung disease.
17717322 IL-13 plays an important role in epithelial repair, and that its effect is mediated through the autocrine release of HB-EGF and activation of EGFR
17703412 Observational study of gene-disease association. (HuGE Navigator)
17644317 S100A8 is regulated by IL-17, dexamethasone, IL-4 and IL-13 in HaCat cells (human keratinocyte cell line)
17623648 ST2 reduced production of IL-4, IL-5, and IL-13 from IL-33-stimulated splenocytes. These results indicate that soluble ST2 acts as a negative regulator of Th2 cytokine production by the IL-33 signaling.
17615386 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17615386 An IL13 polymorphism in the promoter region may modulate the adverse effects of cigarette smoking on pulmonary function in long-term cigarette smokers.
17603012 These findings suggest that airway epithelial cells with upregulation of membrane-bound IL-13Ralpha2 secrete soluble IL-13Ralpha2 into its supernatant, causing the autocrine and paracrine downregulation of the IL-13/STAT6 signal.
17597813 release of active MMP-9 by IL-13-stimulated KCs may play a crucial role in skin inflammation by facilitating migration of leukocytes into the epidermis.
17563406 Expression of IL-13 gene in 70% of patients with allergic asthma was higher than controls (P=0.01)
17561245 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17561245 Polymorphisms in IL13 were significantly associated with serum total IgE and eosinophil count.
17560640 A polymorphic variant of IL-13 (R110Q) was demonstrated to have altered binding affinity to IL-13 receptor alpha2.
17548690 Observational study of gene-disease association. (HuGE Navigator)
17548690 IL13 R110G and C-1112T were associated with increased IgE levels in controls (P < 0.001 and P = 0.04, respectively), and IL13 C-1112T was inversely associated with case-control status (P = 0.05, test for trend in dose model).
17543424 Results concerning the involvement of interleukin 13 pathway in systemic sclerosis need to be confirmed on another larger population. [review]
17517104 Ragweed stimulation significantly increased the production of the Th2-associated cytokines IL-5, IL-9 and IL-13, the chemokines CCL17 and CCL22 and the regulatory cytokine IL-10 in allergic patients
17451413 Observational study of gene-disease association. (HuGE Navigator)
17451413 there was no significant difference in the prevalence of the IL-13 -1112 C-->T and -1512 A-->C SNP among aggressive periodontitis patients and controls in this study
17418380 IL-13 augments TGF-beta 1-induced tissue inhibitor of metalloproteinase-1 expression through increased Smad phosphorylation and may contribute to fibrosis and airway remodeling seen in the presence of T-helper 2 cell inflammation in asthma.
17388919 Observational study of gene-disease association. (HuGE Navigator)
17355643 Observational study of genotype prevalence. (HuGE Navigator)
17347445 IL-13-induces iNOS-derived gas phase nitric oxide in human bronchial epithelial cells
17346294 Observational study of gene-disease association. (HuGE Navigator)
17346294 an association between IL13 polymorphism and cord serum IgE
17313976 Observational study of gene-disease association. (HuGE Navigator)
17313976 study concludes that late wheezing at age 6 years, but not early postbronchiolitis wheezing, is an asthmatic phenomenon and genetically related to a functional IL-13 polymorphism
17303923 Observational study of gene-disease association. (HuGE Navigator)
17303923 an influence of genetic variability at the promoter of IL-4 gene (-590C>T) and a coding region of IL-13 gene (R130Q) on the occurrence of allergic asthma and no relationship between IL-16 promoter polymorphism (-295T>C) and this disease.
17303794 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17291854 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17287067 The present findings suggest that IL-13 is a regulatory factor of VEGF and sFlt-1 production in the human fallopian tubes.
17284225 Observational study of gene-disease association. (HuGE Navigator)
17264150 IL13 mediates the recruitment of reserve cells for fusion during IGF-1-induced hypertrophy of muscle fibers.
17251453 Observational study of gene-disease association. (HuGE Navigator)
17235327 this study demonstrates a synergistic role of IL-13 and TGF-1 in induction of CCL5 that propose a potential role of IL-13 in the skin inflammation by means of facilitating the migration of inflammatory cells in the epidermal compartment
17209513 Observational study of gene-disease association. (HuGE Navigator)
17201240 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17183946 Observational study of gene-disease association. (HuGE Navigator)
17183946 The IL-13 gene +2044G/A mutation has no significant role in susceptibility to and phenotype of inflammatory bowel disease.
17182591 IL-13 biological axis plays an important role during the pathogenesis of BOS independent of the IL-4 biological axis.
17142763 the IL13-1112T allele enhanced IL13 promoter activity in primary human and murine CD4(+) Th2 lymphocytes
17097743 CD4(+)IL-13(+) T cell percentages showed significant negative correlation with revised amyotrophic lateral sclerosis(ALS) functional rating scale scores and significant positive correlation with disease progression rate. IL-13 may contribute to ALS.
17091279 Observational study of gene-disease association. (HuGE Navigator)
17091279 Our results suggest that the IL-13 exon 4 G2044A polymorphism confers susceptibility to the development of allergic rhinitis in Koreans, whereas the IL-4Ralpha Gln551Arg polymorphism is not related to allergic rhinitis.
17090525 differential IL-13 expression may depend on the acquisition of a permissive chromatin architecture at the proximal promoter in Th2 cells rather than the formation of locus-wide repressive chromatin in Th1 cells
17082655 Porcine vascular endothelial cells transduced with recombinant human IL-13 exhibit continuous production of the cytokine and prolonged protection from complement-mediated killing.
17016624 IL13 +2044 G/A may be useful for predicting chronic obstructive pulmonary disease susceptibility.
17006604 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17006604 the IL-13 G+2044A is associated with asthma development
17001290 Observational study of gene-disease association, gene-gene interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16987060 Both IL-4 and IL-13 inhibited the expression of CXCR4, in contrast to CCR5, which was inhibited by IL-13 alone.
16961803 Observational study of gene-disease association. (HuGE Navigator)
16951338 IL-13 induces the association of protein kinase C delta with signal transducer and activator of transcription (Stat)3, not with Stat1, and is required for Stat3 serine-727 phosphorylation.
16918506 Activation of lung mast cells by IL-13 for 5 days increases Fc epsilon receptor type I expression and mast cell proliferation.
16914241 Observational study of gene-disease association. (HuGE Navigator)
16867043 Observational study of gene-disease association. (HuGE Navigator)
16849505 Transgenic IL-13 activates 5-lipoxygenase and is a potent and selective stimulator of enzymes involved in leukotriene metabolism.
16832637 Observational study of gene-disease association. (HuGE Navigator)
16832637 Polymorphisms in IL13 are associated to systemic sclerosis and skin fibrosis
16751012 IL-13 induces systematic modulation of proteins related to the production, catabolism, and function of prostaglandin E2, which might alter inflammatory and immune responses at the level of the epithelium and the submucosa below.
16750991 Observational study of gene-disease association. (HuGE Navigator)
16702372 Observational study of gene-disease association. (HuGE Navigator)
16681592 Observational study of gene-disease association. (HuGE Navigator)
16522370 Data show strong expression of interleukins (IL)-4, IL-10, and IL-13 in different non-leukocytic cell types, especially in endothelial and epithelial cells in the rat, with strong similarity of expresion in humans.
16493441 Observational study of gene-disease association. (HuGE Navigator)
16461126 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16461126 The interaction between SNPs in IL-4/IL-13 pathway significantly influence genetic control of serum IgE levels and development of childhood asthma.
16428771 Strongly associated with periportal fibrosis during chronic schistosomiasis mansoni.
16403098 Observational study of gene-disease association. (HuGE Navigator)
16388492 Observational study of gene-disease association. (HuGE Navigator)
16388492 We found an association between IL13 polymorphism -1112C/T and severe Respiratory Syncycial Virus infection (P = .026). Furthermore, certain Il13/Il4 haplotypes showed an even stronger association with severe RSV infection (P = .0008).
16387595 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16375755 HIV-1 gp120 induces release of IL-13 in CD4+ T cells
16327802 TGF-beta1 production and fibrosis require IL-13 signaling through the IL-13alpha2 receptor
16315031 Observational study of gene-disease association. (HuGE Navigator)
16303333 Diminished post-trauma T cell IL-13 production correlates with increased multiple organ dysfunction syndrome (MODS)independently from any T cell proliferation anergy.
16272823 Observational study of gene-disease association. (HuGE Navigator)
16236836 IL-13 is related to bronchial hyperreactivity in asthmatic patients.
16210662 IL-13 is able to acutely enhance the function of the CD14-positive monocyte subset toward supporting antigen-specific cell-mediated responses in chronic HIV-1 infection.
16200868 Allele T is associated with asthma and increases the total plasma IgE level via enhanced IL-13 gene expression.
16200868 Observational study of gene-disease association. (HuGE Navigator)
16195814 Observational study of gene-disease association. (HuGE Navigator)
16166103 Observational study of gene-disease association. (HuGE Navigator)
16133987 Enhanced allergen-induced secretion of interleukin 13 is a strong predictor of elevated IgE antibody production at ages 2 through 5 years.
16101942 CT genotype of promotor polymorphism C159T in the CD14 gene is associated with lower prevalence of atopic dermatitis and lower IL-13 production.
16046318 Observational study of gene-disease association. (HuGE Navigator)
16034134 Human IL-13 protects porcine endothelial cells from the cytotoxic effects of human complement via activation of the phosphatidylinositide 3-kinase/Akt signaling pathway
16024972 Observational study of gene-disease association. (HuGE Navigator)
16024972 IL-13 gene promoter polymorphism is associated with asthma and/or atopy
16024651 Observational study of gene-disease association. (HuGE Navigator)
16001979 These data suggest that during a respiratory virus infection activated CD8+ T cells from asthmatic subjects may produce excess type 2 cytokines and may contribute to asthma exacerbation by augmenting allergic inflammation.
15969687 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15951665 Observational study of gene-disease association. (HuGE Navigator)
15951665 Polymorphisms in the IL13 gene were associated with each other in whites and African Americans. African Americans with the (-1112)T variant were at increased risk of preterm birth. Some alleles were associated with SGA.
15919378 IL-21 inhibition of human IgE production was not a direct effect on B cells, was not seen following B cell activation with IL-13, and was overcome by CD40 ligation
15904474 Observational study of gene-environment interaction. (HuGE Navigator)
15879126 A study performed in two villages on Mali where Schistosomiasis haematobia is endemic shows that subjects bearing the IL13-1055T/T genotype are on average much less infected than individuals with other genotypes.
15870068 analysis of binding between interleukin-13 and interleukin-13 receptors IL-13Ralpha1 and IL-13Ralpha2
15869882 TH2-cytokines interleukin-4 and -13 have roles in regulating the gene expression pattern of human peripheral blood monocytes
15845862 Allergen-specific T cell lines induced in the presence of salmeterol and fluticasone proprionate inhibited IL-5 and IL-13 production by allergen-specific Th2 cell lines in an IL-10-dependent manner
15820084 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15731584 Observational study of gene-disease association. (HuGE Navigator)
15728267 Observational study of gene-disease association. (HuGE Navigator)
15713213 Observational study of gene-disease association. (HuGE Navigator)
15711639 Data indicate that natural variation in the coding region of interleukin-13 may be an important genetic determinant of susceptibility to allergy.
15699166 In transgenic mice in which IL-13 is targeted to the lung, IL-13 is a potent stimulator of lung inflammation and remodeling via IL-11 receptor alpha-dependent pathways.
15687724 Observational study of gene-disease association. (HuGE Navigator)
15661077 The data supports the hypothesis that gene modulation by IL-13 in ASM may be essential for the events leading to the development of allergic asthma.
15660293 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15642470 IL13 was one of two biologically active chimeric fusion proteins that had its expression optimized and was also purified.
15634905 This first transcriptome analysis of human monocytes after stimulation with IL-13 in vitro reveals its striking modulation of genes involved with IL-1 beta signal transduction and biological activity.
15596681 Observational study of gene-disease association. (HuGE Navigator)
15528258 IL-4 and IL-13 mediate the hypercontractility of intestinal muscle via a STAT6 pathway at the level of the smooth muscle cell. The STAT6 pathway may contribute to the hypercontractility of intestinal muscle in Crohn's disease.
15488706 IL-13 has a role in chronic autoimmune urticaria and chronic idiopathic urticaria
15483090 Observational study of gene-disease association. (HuGE Navigator)
15474066 IL-4 and IL-13 secreted from embryo during implantation may up-regulate TARC by endometrial epithelial cells.
15388001 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15361241 role of IL-13 in the skin and IFN-gamma in the liver in protective immunity against schistosomes [review]
15356573 Human B lymphocytes produce significant IL-13, and neutralization of IL-13 impairs IgE synthesis. IL-13 might be an important autocrine growth factor for IgE-producing B lymphocytes.
15356556 Either Q110 IL-13 variant or V50R551 IL-4R alpha variant has enhanced function alone, but the 2 together have a synergistic effect on IL-13-dependent gene induction.
15315330 Observational study of gene-disease association. (HuGE Navigator)
15308043 Observational study of gene-disease association. (HuGE Navigator)
15229217 IL13 gene transcription is regulated by NFAT2 and GATA proteins in mast cells
15191916 The induction of IL-13 and MCP-1 gene expression by IL-1beta was accompanied by the activation of IL-1 receptor-associated kinase and translocation of NF KAPPA B into the nucleus.
15187156 demonstrated induction of IgE synthesis by the interaction between adenosine-stimulated mast cells and B lymphocytes involves up-regulation of IL-4 and IL-13 mediated by A(2B) receptors
15163899 Th2 cytokines IL-4 and IL-13 downregulate paxillin production by BAEC, thereby disrupting the cell-matrix interactions
15163701 HTLV-1 tax protein, by transactivating the promoter, induces IL-13 overexpression that possibly leads to an autocrine stimulation of HTLV-1-infected lymphocyte cells.
15155645 Significantly higher levels were found in soluble egg antigen-stimulated PBMC from schistosomiasis mansoni patients with degree III hepatic fibrosis compared to patients with degree I or II fibrosis, and in patients untreated for 1 year.
15155567 Recombinant human IL-13 acts in synergy with IL-1beta to stimulate growth by coordinately up-regulating PDGF-AA and the PDGF-Ralpha, respectively.
15146247 Ulcerative colitis is associated with an atypical Th2 response mediated by nonclassical NKT cells producing IL-13 and having cytotoxic potential for epithelial cells.
15014952 Upregulation of IL-13 mRNA in subacute and chronic lesions of atopic dermatitis along with scant expression of IL-4 mRNA suggest that IL-13 is a crucial cytokine in lesional skin.
15007355 Observational study of gene-disease association. (HuGE Navigator)
15007352 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
15007352 variants in the IL4, IL13, and IL4RA genes play an important role in controlling specific IgE response in atopy
15005726 Observational study of gene-disease association. (HuGE Navigator)
15004182 IL-13 induces the specific goblet cell product trefoil factor-3 (TTF3) expression via a direct effect on intestinal epithelial cells, through a STAT6- and de novo protein synthesis-dependent pathway.
14984938 Normal ovary and ovarian tumors express IL-13 and IL-15 and pattern of their expression in carcinomas suggests that these cytokines may function in various ovarian cellular activities including inflammatory/immune responses.
14983029 Th2 cytokine gene cluster during human Th1/Th2 differentiation and in a transgenic mouse line containing the human IL-4/IL-13 genes for intergenic transcripts
14764428 These findings indicate that the CD38/cADPR-dependent pathway has a major role in IL-13-induced modulation of calcium signaling in human airway smooth muscle.
14756548 Decrease in blood levels observed after surgical removal of laryngeal squamous cell carcinoma.
14734771 IL-13 up-regulates CD40L expression in normal human lung fibroblasts as well as fibroblasts from scarred lung tissue.
14669230 Observational study of gene-disease association. (HuGE Navigator)
14634100 IL-13 up-regulates SOCS-1 expression in A549 human lung adenocarcinoma cells by stimulating interaction of STAT6 with three interferon-gamma-activated sequence (GAS)motifs in the SOCS-1 promoter.
14564352 Observational study of gene-disease association. (HuGE Navigator)
14564352 Variant Gln110 associated with increased total serum IgE levels in atopy and was weakly associated with bronchial asthma. No association of variant with juvenile idiopathic arthritis(JIA). Variant Gln110 significantly less frequent in JIA.
14561191 interleukin-13 has emerged as promising means of improving allergic states, and several antagonists have been developed--REVIEW
14551608 Observational study of gene-disease association. (HuGE Navigator)
14512310 data challenge the notion that acute graft-versus-host disease is purely a Th1-type cytokine-driven response, high-lighting a novel and highly significant link between the Th2-type cytokine IL-13 and aGVHD
14510917 Observational study of gene-disease association. (HuGE Navigator)
12944981 Observational study of gene-disease association. (HuGE Navigator)
12935900 These results suggest that MIP-T3 is a novel inhibitor of IL-13 signaling and may be a useful molecule in ameliorating various conditions in which IL-13 plays a central role.
12928861 Observational study of gene-disease association. (HuGE Navigator)
12928861 There is a common IL-13 Arg130Gln single nucleotide polymorphism among Chinese atopy patients with allergic rhinitis.
12920029 IL-13 production was directly related to the level of Tax expression in the infected CD4+ T cells
12897746 Observational study of gene-disease association. (HuGE Navigator)
12897746 Variants C-1055T and Arg130Gln of the interleukin 13 gene might play an important role on total serum IgE production.
12884288 expression of alleles of the genes encoding IL-2, IL-3, IL-4, and IL-13 in CD4(+) T cell clones
12794003 IL-13 is in part able to induce a mucus hypersecretory phenotype through a direct interaction with the airway epithelium and that MAP kinase and PtdIns 3-kinase signaling pathways are involved.
12748907 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12748907 IL13 is associated with diabetes mellitus, type 1 in Filipinos.
12748293 Results provide evidence that interleukin-13 induces p38 MAP kinase phosphorylation and activation, which regulates Stat1 and Stat3 serine 727 phosphorylation.
12704784 role in regulating vascular cell adhesion molecule-1 expression in human osteoblasts
12682264 IL-13 synergistically augments eotaxin production by leukotriene C4 via up-regulation of CysLT1R expression on lung fibroblasts.
12654630 CC chemokine receptor 3 mobilizes to the surface of human mast cells and potentiates immunoglobulin E-dependent generation of this protein.
12594065 Observational study of gene-disease association. (HuGE Navigator)
12594065 Allele frequency of IL-13 polymorphism was not associated with rapid decline of lung function in smokers.
12548511 It was impossible to evaluate whether in vitro cytokine production profiles really can be deduced from a particular cytokine gene polymorphism.
12525574 Protease allergen Der p1 and the secreted proteases of the hookworm Necator americanus are able to directly induce type 2 cytokines IL-4, IL-5, and IL-13 by basophils, that could promote IgE synthesis, eosinophil recruitment, and Th2 cells.
12441140 modulates thymus and activation-regulated chemokine/CCL17 and interferon-induced protein of 10kDA/CXCL10 release by tumor necrosis factor-alpha and interferon-gamma in HaCaT cell line
12424628 Observational study of gene-disease association. (HuGE Navigator)
12413765 Observational study of gene-disease association. (HuGE Navigator)
12396617 Adenovirus-mediated gene transfer of human IL-13 has cytoprotective functions in vitro, suggesting in vivo synergy of Ad-IL-13 and regulatory cells in the infectious transplantation tolerance pathway. Heme oxygenase-1 may be an IL-13 downstream effector.
12377947 eosinophils synthesize and store IL-13
12370400 IL-13 in combination with TGF-beta 1 increases production of eotaxin-1 in airway fibroblasts from asthmatic and normal subjects.
12370393 Expression of IL-13 mRNA and the FMLP-induced release of IL-13 from basophils are both inhibited by preincubation of the cells with synthetic HIV-1 envelope gp41 peptides.
12223527 The receptor components and upstream signaling events initiated by IL-13 in primary human blood monocytes include: IL-4R(alpha), IL-2Rgammac, IL-13R(alpha)1 and IL-13R(alpha)2, Jak2, Tyk2, and Stat proteins 1alpha, 3, 5A, 5B, & 6.
12207328 In lung fibroblasts IL13 induces the expression of the gamma c chain & its association with JAK3. In myofibroblasts, IL13 triggers formation of a new type of functional receptor (p-IL-4Ralpha /IL-13Ralpha 1/gamma c) & recruitment/phosphorylation of JAK3.
12189139 Alanine-scanning mutagenesis of the alpha-helix D segment reveals new functionally important residues
12165514 DNA methylation around the IL-4 and IL-13 genes before and after T cell differentiation
12163193 Increased IL-13 but not IL-5 production by CD4-positive T cells and CD8-positive T cells in multiple sclerosis during relapse phase.
12152987 Review. The biologic activities of IL-13 in the immune system, the evidence implicating IL-13 as an autocrine growth factor for RS cells in Hodgkin's disease, & the potential influence of IL-13 on the HD reactive inflammatory infiltrate are discussed.
12097410 Eosinophils (but not neutrophils) produce and release functional IL-13 in allergic, infectious, and idiopathic eosinophilic diseases, as well as after in vitro exposure to GM-CSF or IL-5.
12089714 Observational study of gene-disease association. (HuGE Navigator)
12089333 HIV-1 gp120 induces release of IL-13 in CD4+ T cells
12067309 increased expression of IL-13 in CD4+ cell from patients with hyper-IgE could account, at least partly, for raised IgE levels in those individuals.
12063528 Observational study of gene-disease association. (HuGE Navigator)
12063528 variant might act as a functional genetic factor of bronchial asthma with a unique mechanism to upregulate local and systemic IL-13 concentration in vivo.
11980568 Observational study of gene-disease association. (HuGE Navigator)
11940068 IL-13 has been implicated in the pathogenesis of asthma and in the regulation of IgE synthesis in humans.
11830476 The ability to produce the type 2 cytokines IL-13 and IL-5 defines CD161(+) NK cells at intermediate stages of differentiation, and is lost upon terminal functional differentiation.
11825773 Observational study of gene-disease association. (HuGE Navigator)
11825773 investigated a possible association of a variant of the IL-13 gene, with the immunologically hyper-reactive sowda form of onchocerciasis
11786536 novel mechanism by which IFN-gamma can regulate IL-13 responses.
11709756 gene-gene interaction in asthma: IL4RA and IL13 in a Dutch population with asthma
11678850 Observational study of gene-disease association. (HuGE Navigator)
11588017 Observational study of gene-disease association. (HuGE Navigator)
11396683 HIV-1 gp120 induces release of IL-13 in CD4+ T cells
11149986 HIV-1 gp120 induces release of IL-13 in CD4+ T cells
10623799 HIV-1 gp120 induces release of IL-13 in CD4+ T cells
9226003 HIV-1 gp120 induces release of IL-13 in CD4+ T cells

AA Sequence

MHPLLNPLLLALGLMALLLTTVIALTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSI      1 - 70
NLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLF     71 - 140
REGRFN                                                                    141 - 146
//

Text Mined References (541)

PMID Year Title
26986948 2016 An Interleukin 13 Polymorphism Is Associated with Symptom Severity in Adult Subjects with Ever Asthma.
26897823 2015 The Role of Interleukin-13 in Patients with Rheumatic Valvular Fibrosis: A Clinical and Histological Study.
26831416 2015 A preliminary study on the association of single nucleotide polymorphisms of interleukin 4 (IL4), IL13, IL4 receptor alpha (IL4R?) & Toll-like receptor 4 (TLR4) genes with asthma in Indian adults.
26693492 2015 Autoimmune Hepatitis in Brazilian Children: IgE and Genetic Polymorphisms in Associated Genes.
26516307 2015 Single Nucleotide Polymorphisms in IL-10, IL-12p40, and IL-13 Genes and Susceptibility to Glioma.
26474238 2016 Genome-Wide Methylation Study Identifies an IL-13-induced Epigenetic Signature in Asthmatic Airways.
26436920 2015 miR-142-5p and miR-130a-3p are regulated by IL-4 and IL-13 and control profibrogenic macrophage program.
26418997 2015 [Association of TNF-alpha and IL-13 genes polymorphisms with bronchial asthma].
26407210 2016 IL-13 Augments Compressive Stress-Induced Tissue Factor Expression in Human Airway Epithelial Cells.
26399722 2016 Association between DNA hypomethylation at IL13 gene and allergic rhinitis in house dust mite-sensitized subjects.
26387812 2015 Association of single nucleotide polymorphisms in IL8 and IL13 with sunitinib-induced toxicity in patients with metastatic renal cell carcinoma.
26365633 2016 Lack of association between RAD50-IL13 polymorphisms and pediatric asthma susceptibility in Northeastern Han Chinese.
26335962 2015 The TLR4-associated phospholipase D1 activation is crucial for Der f 2-induced IL-13 production.
26258681 2015 An IL-13 promoter polymorphism associated with liver fibrosis in patients with Schistosoma japonicum.
26246572 2015 Constitutive Activation of Interleukin-13/STAT6 Contributes to Kaposi's Sarcoma-Associated Herpesvirus-Related Primary Effusion Lymphoma Cell Proliferation and Survival.
26192556 2015 The Causal Role of IL-4 and IL-13 in Schistosoma mansoni Pulmonary Hypertension.
26088754 2015 Mast cell production and response to IL-4 and IL-13.
26073683 2015 The differential expression of IL-4 and IL-13 and its impact on type-2 immunity.
26072972 2015 TL1A as a Potential Local Inducer of IL17A Expression in Colon Mucosa of Inflammatory Bowel Disease Patients.
26070934 2015 IL-4 and IL-13 signaling in allergic airway disease.
26046681 2015 Salivary Immunosuppressive Cytokines IL-10 and IL-13 Are Significantly Elevated in Oral Squamous Cell Carcinoma Patients.
26044597 2015 T helper 2 (Th2) cell differentiation, type 2 innate lymphoid cell (ILC2) development and regulation of interleukin-4 (IL-4) and IL-13 production.
26039103 2015 Th2 cytokines inhibit lymphangiogenesis.
25976462 2015 Mechanism of interleukin-13 production by granulocyte-macrophage colony-stimulating factor-dependent macrophages via protease-activated receptor-2.
25973044 2015 Expression of IL-4 and IL-13 predicts recurrence and survival in localized clear-cell renal cell carcinoma.
25848896 2015 Expression of surfactant protein D in airways of asthmatics and interleukin-13 modulation of surfactant protein D in human models of airway epithelium.
25784274 2015 IL-13 mediates IL-33-dependent mast cell and type 2 innate lymphoid cell effects on bronchial epithelial cells.
25769912 2015 Childhood allergic asthma is associated with increased IL-13 and FOXP3 histone acetylation.
25683991 2015 Effects of interleukin-13 and montelukast on the expression of zonula occludens-1 in human podocytes.
25674935 2015 Expression of POSTN, IL-4, and IL-13 in Chronic Rhinosinusitis with Nasal Polyps.
25658755 2015 Association between polymorphism of the interleukin-13 gene and susceptibility to hepatocellular carcinoma in the Chinese population.
25633855 2015 Granulocyte-macrophage colony-stimulating factor primes interleukin-13 production by macrophages via protease-activated receptor-2.
25628470 2015 Interleukin-13 is overexpressed in cutaneous T-cell lymphoma cells and regulates their proliferation.
25502839 2014 A meta-analysis of IL-13 polymorphisms and pediatric asthma risk.
25453333 2014 The roles of ADAM33, ADAM28, IL-13 and IL-4 in the development of lung injuries in children with lethal non-pandemic acute infectious pneumonia.
25389033 2015 Neurotrophic tyrosine kinase receptor 1 is a direct transcriptional and epigenetic target of IL-13 involved in allergic inflammation.
25172500 2014 T cell-derived IL-4/IL-13 protects mice against fatal Schistosoma mansoni infection independently of basophils.
25065568 2015 Defective basement membrane in atopic dermatitis and possible role of IL-13.
24990692 2014 Lack of association between the G+2044A polymorphism of interleukin-13 gene and chronic obstructive pulmonary disease: a meta-analysis.
24966400 2014 The role of interleukin-13 in the removal of hyper-radiosensitivity by priming irradiation.
24920014 2014 A meta-analysis of Hodgkin lymphoma reveals 19p13.3 TCF3 as a novel susceptibility locus.
24886277 2014 TGF beta and IL13 in Schistosomiasis mansoni associated pulmonary arterial hypertension; a descriptive study with comparative groups.
24879793 2014 Endogenously expressed IL-13R?2 attenuates IL-13-mediated responses but does not activate signaling in human lung fibroblasts.
24848505 2014 Additive effect between IL-13 polymorphism and cesarean section delivery/prenatal antibiotics use on atopic dermatitis: a birth cohort study (COCOA).
24833143 Low serum interleukin-13 levels correlate with poorer prognoses for colorectal cancer patients.
24822215 2014 IL-33 enhanced the proliferation and constitutive production of IL-13 and IL-5 by fibrocytes.
24808368 2014 Intravenous immunoglobulin treatment in humans suppresses dendritic cell function via stimulation of IL-4 and IL-13 production.
24564787 2014 Lack of association between the IL-13 C-1112T, G2044A polymorphisms and Graves' disease risk: evidence from a meta-analysis.
24510479 2014 Interleukin-4 and interleukin-13 compromise the sinonasal epithelial barrier and perturb intercellular junction protein expression.
24447084 2014 Quantification of circulating house dust mite-specific IL-4- and IL-13-secreting T cells correlates with rhinitis severity in asthmatic children and varies with the seasons.
24447082 2014 Differential expression of 11?-hydroxysteroid dehydrogenase type 1 and 2 in mild and moderate/severe persistent allergic nasal mucosa and regulation of their expression by Th2 cytokines: asthma and rhinitis.
24363163 2014 Linking GATA-3 and interleukin-13: implications in asthma.
24338253 2014 The effects of vitamin D on allergen-induced expression of interleukin-13 and interleukin-17 in cord blood CD4?T cells.
24286397 2013 Association between the interleukin-13 gene and development of chronic obstructive pulmonary disease in southern Chinese Han population: a case-control study.
24280725 2014 In vitro assessment of IL-4- or IL-13-mediated changes in the structural components of keratinocytes in mice and humans.
24241537 2014 A genome-wide association study identifies CDHR3 as a susceptibility locus for early childhood asthma with severe exacerbations.
24105413 2013 Autocrine role of interleukin-13 on skeletal muscle glucose metabolism in type 2 diabetic patients involves microRNA let-7.
24053708 2013 Interleukin-13 and RANTES polymorphisms in relation to asthma in children of Chinese Han nationality.
24001799 2013 IL-13/IL-22-coproducing T cells, a novel subset, are increased in atopic dermatitis.
23996716 2013 IL-13 gene polymorphisms and their association with atopic asthma and rhinitis in Pakistani patients.
23893513 Role of interleukin-13 in fibrosis, particularly systemic sclerosis.
23886662 2013 A genome-wide association study of atopic dermatitis identifies loci with overlapping effects on asthma and psoriasis.
23874547 2013 Interleukin-13 -1112 C/T promoter polymorphism confers risk for COPD: a meta-analysis.
23865080 2013 Single nucleotide polymorphism in the promoter of the human interleukin-13 gene is associated with asthma in Malaysian adults.
23841068 2013 Interleukin-13 +1923C/T polymorphism is associated with asthma risk: a meta-analysis.
23817569 2013 A genome-wide association meta-analysis of self-reported allergy identifies shared and allergy-specific susceptibility loci.
23815671 2013 Interactive effect of STAT6 and IL13 gene polymorphisms on eczema status: results from a longitudinal and a cross-sectional study.
23810766 2013 IL-33 is more potent than IL-25 in provoking IL-13-producing nuocytes (type 2 innate lymphoid cells) and airway contraction.
23754348 2013 Raised interleukin-13 levels in cord blood increases the risk of allergic sensitization at 5 years of age.
23713409 2013 Effects of the inflammatory cytokines TNF-? and IL-13 on stromal interaction molecule-1 aggregation in human airway smooth muscle intracellular Ca(2+) regulation.
23682108 2014 Interleukin-13 induces collagen type-1 expression through matrix metalloproteinase-2 and transforming growth factor-?1 in airway fibroblasts in asthma.
23666277 2013 Replication and fine mapping of asthma-associated loci in individuals of African ancestry.
23663500 2013 Genetic association between selected cytokine genes and glioblastoma in the Han Chinese population.
23617596 2013 Genetic variants of the genes encoding zinc finger protein 313 and interleukin-13 confer a risk for psoriasis in a Chinese Uygur population.
23614810 2013 Cytokine patterns differ seasonally between women with and without uterine leiomyomata.
23549736 2013 Association of the SNP rs1800925(C/T) in the interleukin-13 gene promoter with pulmonary function in Chinese Han patients with idiopathic pulmonary fibrosis.
23545317 2013 Association of interleukin-13 SNP rs20541 with allergic rhinitis risk: a meta-analysis.
23521898 2013 Interleukin (IL)-13 promoter polymorphisms (-7402 T/G and -4729G/A) condition susceptibility to pediatric severe malarial anemia but not circulating IL-13 levels.
23510983 Differential effects of interleukin-13 and interleukin-6 on Jak/STAT signaling and cell viability in pancreatic ?-cells.
23437086 2013 Effects of polymorphisms -1112C/T and +2044A/G in interleukin-13 gene on asthma risk: a meta-analysis.
23395224 2013 Association between polymorphisms in interleukin-4R? and interleukin-13 and glioma risk: a meta-analysis.
23382814 2013 Interleukin-13 genetic variants, household carpet use and childhood asthma.
23376457 2013 Cytokine gene polymorphisms in Tunisian endemic pemphigus foliaceus: a possible role of il-4 variants.
23351078 2013 IL-4 and IL-13 inhibit IL-1? and TNF-? induced kinin B1 and B2 receptors through a STAT6-dependent mechanism.
23333326 2013 15-Deoxy-?(12,14)-prostaglandin J2 inhibits IL-13 production in T cells via an NF-?B-dependent mechanism.
23317483 2012 Interleukin-13 promoter gene polymorphism -1112 C/T is associated with atopic dermatitis in Polish patients.
23300643 2012 IL-13 promotes collagen accumulation in Crohn's disease fibrosis by down-regulation of fibroblast MMP synthesis: a role for innate lymphoid cells?
23249391 2013 TGF-?? decreases baseline and IL-13-stimulated mucin production by primary human bronchial epithelial cells.
23246181 2013 Association between IL13 gene polymorphisms and susceptibility to cancer: a meta-analysis.
23223131 2013 CD8(+) T cells in the lesional skin of atopic dermatitis and psoriasis patients are an important source of IFN-?, IL-13, IL-17, and IL-22.
23222300 2012 Cytokine stimulation of epithelial cancer cells: the similar and divergent functions of IL-4 and IL-13.
23184931 2013 From macrophage interleukin-13 receptor to foam cell formation: mechanisms for ?M?2 integrin interference.
23171465 2012 Association between non-atopic hand eczema and interleukin-13 gene polymorphism in Taiwanese nursing population.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23108822 2012 Interleukin-13 gene polymorphisms at -1055 C/T and +2044 G/A positions in patients with squamous cell carcinoma of head and neck.
23070918 2013 Association between the interleukin-4, interleukin-13 polymorphisms and asthma: a meta-analysis.
23045480 2012 Interleukin 13 exposure enhances vitamin D-mediated expression of the human cathelicidin antimicrobial peptide 18/LL-37 in bronchial epithelial cells.
23042114 2012 Genome-wide association study identifies eight new susceptibility loci for atopic dermatitis in the Japanese population.
22981205 2012 Combining gene expression microarray- and cluster analysis with sequence-based predictions to identify regulators of IL-13 in allergy.
22952702 2012 Leukotriene D4 and interleukin-13 cooperate to increase the release of eotaxin-3 by airway epithelial cells.
22846750 2012 Interaction between IL13 genotype and environmental factors in the risk for allergic rhinitis in Korean children.
22750299 2012 Association of interleukin-13 SNP rs1800925 with allergic rhinitis risk: a meta-analysis based on 1,411 cases and 3169 controls.
22749024 Analysis of the rs20541 (R130Q) polymorphism in the IL-13 gene in patients with elderly-associated chronic inflammatory diseases.
22741617 2012 The lL-8 and IL-13 gene polymorphisms in inflammatory bowel disease and colorectal cancer.
22698804 2012 Serum levels of interleukin-13 and interferon-gamma from adult patients with asthma in Mysore.
22686311 2012 Impact of interleukin-13 and -18 promoter polymorphisms in health care workers with natural rubber latex allergy.
22661199 2012 Interleukin-13-induced activation of signal transducer and activator of transcription 6 is mediated by an activation of Janus kinase 1 in cultured human bronchial smooth muscle cells.
22574126 2012 Functional polymorphisms in IL13 are protective against high Schistosoma mansoni infection intensity in a Brazilian population.
22573806 2012 MAPK regulation of IL-4/IL-13 receptors contributes to the synergistic increase in CCL11/eotaxin-1 in response to TGF-?1 and IL-13 in human airway fibroblasts.
22534877 2012 Follow-up study of the first genome-wide association scan in alopecia areata: IL13 and KIAA0350 as susceptibility loci supported with genome-wide significance.
22521249 2012 TH2 cytokines increase kallikrein 7 expression and function in patients with atopic dermatitis.
22506826 2012 Alterations in methylation status of immune response genes promoters in cell-free DNA during a hemodialysis procedure.
22471460 2011 Lack of associations of polymorphisms of IL-7R, IL-13 and IL-15 with NSCLCs in non-smoking Chinese.
22441356 2012 Expression of interleukin-4 and interleukin-13 and their receptors in colorectal cancer.
22432974 2012 Environmental tobacco smoke and male sex modify the influence of IL-13 genetic variants on cord blood IgE levels.
22407982 2012 Equilibrium and kinetic analysis of human interleukin-13 and IL-13 receptor alpha-2 complex formation.
22376040 2012 Gene-gene interactions between candidate gene polymorphisms are associated with total IgE levels in Korean children with asthma.
22370092 2012 Oxidant signaling for interleukin-13 gene expression in lung smooth muscle cells.
22355542 2011 The Role of TSLP in IL-13-induced atopic march.
22325047 2012 A common variant associated with asthma, interleukin 13 R130Q, promotes the production of IgE.
22317767 2012 Polymorphisms in the IL-13 and IL-4R genes are associated with the development of renal cell carcinoma.
22287592 2013 Interleukin-13 and transforming growth factor ? synergise in the pathogenesis of human intestinal fistulae.
22286212 2012 Genome-wide association study of classical Hodgkin lymphoma and Epstein-Barr virus status-defined subgroups.
22236719 2012 The relationship among IL-13, GSTP1, and CYP1A1 polymorphisms and environmental tobacco smoke in a population of children with asthma in Northern Mexico.
22229804 2012 Enveloped virus but not bacteria block IL-13 responses in human cord blood T cells in vitro.
22226971 2012 Coordinated regulation of IL-4 and IL-13 expression in human T cells: 3C analysis for DNA looping.
22222605 2012 IL-13 polymorphisms contribute to the risk of asthma: a meta-analysis.
22204768 2011 IL-13 and its genetic variants: effect on current asthma treatments.
22170601 2012 The polymorphisms of IL-4, IL-4R and IL-13 genes and bladder cancer risk in a Chinese population: a case-control study.
22166239 2011 Association of -1112 c/t promoter region polymorphism of the interleukin 13 gene with occurrence of colorectal cancer.
22154382 2012 IL-13 dampens human airway epithelial innate immunity through induction of IL-1 receptor-associated kinase M.
22123380 2011 IL-13 and IL-17A gene polymorphisms in Japanese patients with aspirin-exacerbated respiratory disease.
22092872 2012 Interleukin-4 and interleukin-13 prime migrational responses of haemopoietic progenitor cells to stromal cell-derived factor-1?.
22087298 2011 Association study on IL4, IL13 and IL4RA polymorphisms in mite-sensitized persistent allergic rhinitis in a Chinese population.
22075330 2012 A genome-wide association study of plasma total IgE concentrations in the Framingham Heart Study.
22053598 2011 Association of TGF-beta1, IL-4 and IL-13 gene polymerphisms with asthma in a Chinese population.
22045834 2012 Polymorphisms in the interleukin 4, interleukin 13, and corresponding receptor genes are not associated with systemic sclerosis and do not influence gene expression.
22039304 2011 c-Myb and GATA-3 cooperatively regulate IL-13 expression via conserved GATA-3 response element and recruit mixed lineage leukemia (MLL) for histone modification of the IL-13 locus.
22039015 2011 Requirement of GATA-binding protein 3 for II13 gene expression in IL-18-stimulated Th1 cells.
22023794 2011 Case-control study of IL13 polymorphisms, smoking, and rhinoconjunctivitis in Japanese women: the Kyushu Okinawa Maternal and Child Health Study.
22013915 2011 IL13 genetic polymorphisms, smoking, and eczema in women: a case-control study in Japan.
21920770 2011 Role of IL-13 in systemic sclerosis.
21913997 2011 Association of polymorphisms in genes encoding IL-4, IL-13 and their receptors with atopic dermatitis in a Korean population.
21762457 2011 Association of interleukin-13 C-1112T and G+2044A polymorphisms with asthma: a meta-analysis.
21677024 2011 Potential role of IL-13 in neuroprotection and cortical excitability regulation in multiple sclerosis.
21616524 2011 Let-7 microRNA-mediated regulation of IL-13 and allergic airway inflammation.
21613309 2011 IL13 gene polymorphism is a marker for psoriatic arthritis among psoriasis patients.
21576506 2011 IL-13 induces skin fibrosis in atopic dermatitis by thymic stromal lymphopoietin.
21489615 2011 Hexamethylene diisocyanate asthma is associated with genetic polymorphisms of CD14, IL-13, and IL-4 receptor ?.
21478113 2010 Anti-inflammatory plasma cytokines in children and adolescents with Down syndrome.
21430433 2011 Effect of genetic variation of IL-13 on airway remodeling in bronchial asthma.
21426411 2011 Combined occurrence of filaggrin mutations and IL-10 or IL-13 polymorphisms predisposes to atopic dermatitis.
21425907 2011 Interleukin-13 receptor A1 gene polymorphism and IL-13 serum level in atopic and non-atopic Egyptian children.
21325281 2011 Epigenetic regulation of the IL-13-induced human eotaxin-3 gene by CREB-binding protein-mediated histone 3 acetylation.
21289305 2011 Computational and experimental analysis reveals a requirement for eosinophil-derived IL-13 for the development of allergic airway responses in C57BL/6 mice.
21275604 2010 Interleukin-13 induces mucin 5AC production involving STAT6/SPDEF in human airway epithelial cells.
21239604 2011 Up-regulation of MUC18 in airway epithelial cells by IL-13: implications in bacterial adherence.
21236478 2011 Human TH17 cells express a functional IL-13 receptor and IL-13 attenuates IL-17A production.
21235536 2011 Association of functional polymorphisms in promoter regions of IL5, IL6 and IL13 genes with development and prognosis of autoimmune thyroid diseases.
21198753 2011 Production of interleukin-13 is influenced by the interleukin-4 -34TT and -590TT genotype in patients with aggressive periodontitis.
21191416 2011 Expression of matrix metalloproteinase-13 is controlled by IL-13 via PI3K/Akt3 and PKC-? in normal human dermal fibroblasts.
21191414 2011 IL-4 and IL-13 alter plasmacytoid dendritic cell responsiveness to CpG DNA and herpes simplex virus-1.
21097505 2011 The interleukin 13 (IL-13) pathway in human macrophages is modulated by microRNA-155 via direct targeting of interleukin 13 receptor alpha1 (IL13Ralpha1).
21076368 2011 Effects of IL-13 on mucociliary differentiation of pediatric asthmatic bronchial epithelial cells.
21071541 2011 Risk of cervical cancer associated with allergies and polymorphisms in genes in the chromosome 5 cytokine cluster.
21067601 2010 The effect of interleukin-13 (IL-13) and interferon-? (IFN-?) on expression of surfactant proteins in adult human alveolar type II cells in vitro.
21061265 2011 Hodgkin disease risk: role of genetic polymorphisms and gene-gene interactions in inflammation pathway genes.
20975284 2011 Case-control study of eczema associated with IL13 genetic polymorphisms in Japanese children.
20942272 2010 Helicobacter pylori infection and cytokine gene polymorphisms in Uzbeks.
20861864 2011 Association of rs7719175, located in the IL13 gene promoter, with Schistosoma haematobium infection levels and identification of a susceptibility haplotype.
20860503 2010 A large-scale, consortium-based genomewide association study of asthma.
20811626 2010 Genetic variants in inflammation-related genes are associated with radiation-induced toxicity following treatment for non-small cell lung cancer.
20802378 2010 A multiplex MALDI-TOF MS approach facilitates genotyping of DNA from formalin-fixed paraffin-embedded tumour specimens.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20714168 2011 Serum adiponectin, TNF-?, IL-12p70, and IL-13 levels in multiple sclerosis and the effects of different therapy regimens.
20703737 2012 The association forecasting of 13 variants within seven asthma susceptibility genes on 3 serum IgE groups in Taiwanese population by integrating of adaptive neuro-fuzzy inference system (ANFIS) and classification analysis methods.
20652946 2010 IL-13 upregulates GPIIb expression in megakaryocytic cell lines via STAT6.
20644561 2011 A large-scale candidate gene approach identifies SNPs in SOD2 and IL13 as predictive markers of response to preoperative chemoradiation in rectal cancer.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20603037 2010 Single nucleotide polymorphisms in inflammation-related genes are associated with venous thromboembolism.
20589076 2010 Hypomethylation of IL10 and IL13 promoters in CD4+ T cells of patients with systemic lupus erythematosus.
20572918 2010 Investigation of interleukin-13 gene polymorphisms in individuals with chronic and generalized aggressive periodontitis in a Taiwanese (Chinese) population.
20568250 2010 Common single nucleotide polymorphisms in immunoregulatory genes and multiple myeloma risk among women in Connecticut.
20543112 2010 IL-13 induces esophageal remodeling and gene expression by an eosinophil-independent, IL-13R alpha 2-inhibited pathway.
20539013 2011 Goblet cells are derived from a FOXJ1-expressing progenitor in a human airway epithelium.
20536507 2010 Independent predictive roles of eotaxin Ala23Thr, paraoxonase 2 Ser311Cys and beta-adrenergic receptor Trp64Arg polymorphisms on cardiac disease in Type 2 Diabetes--an 8-year prospective cohort analysis of 1297 patients.
20530519 2010 Interleukin 4 and STAT6 gene polymorphisms are associated with systemic lupus erythematosus in Chinese patients.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20485362 2010 Association analysis of susceptibility candidate region on chromosome 5q31 for tuberculosis.
20484924 2010 Interleukin 13 and interleukin 4 receptor-? polymorphisms in rhinitis and asthma.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20444155 2010 Joint influences of Acidic-Mammalian-Chitinase with Interleukin-4 and Toll-like receptor-10 with Interleukin-13 in the genetics of asthma.
20418295 2010 Genetic predisposition to natural rubber latex allergy differs between health care workers and high-risk patients.
20418110 2010 Polymorphisms in cytokine genes and serum cytokine levels among New Mexican women with and without breast cancer.
20406594 The effects of natural pollen exposure on inflammatory cytokines and their relationship with nonspecific bronchial hyperresponsiveness in seasonal allergic rhinitis.
20403914 2010 Comprehensive analysis of the cytokine-rich chromosome 5q31.1 region suggests a role for IL-4 gene variants in prostate cancer risk.
20403202 2010 Birth order modifies the effect of IL13 gene polymorphisms on serum IgE at age 10 and skin prick test at ages 4, 10 and 18: a prospective birth cohort study.
20395963 2010 Replication of genetic association studies in asthma and related phenotypes.
20394509 2010 Association and gene-gene interactions of eight common single-nucleotide polymorphisms with pediatric asthma in middle china.
20368097 2010 GATA3 siRNA inhibits the binding of NFAT1 to interleukin-13 promoter in human T cells.
20358028 2010 IL-13 Gene Polymorphisms are Associated With Rhinosinusitis and Eosinophilic Inflammation in Aspirin Intolerant Asthma.
20332709 2010 Association analysis of polymorphisms in IL-3, IL-4, IL-5, IL-9, and IL-13 with Graves' disease.
20306654 2007 Role of IL-13 in the pathogenesis of bronchial asthma.
20299965 2010 Cytokine signaling pathway polymorphisms and AIDS-related non-Hodgkin lymphoma risk in the multicenter AIDS cohort study.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20236697 2010 Thymic stromal lymphopoietin-induced human asthmatic airway epithelial cell proliferation through an IL-13-dependent pathway.
20224668 2009 No evidence of association between interleukin-13 gene polymorphism in aspirin intolerant chronic urticaria.
20223216 2010 Molecular basis for shared cytokine recognition revealed in the structure of an unusually high affinity complex between IL-13 and IL-13Ralpha2.
20219689 2010 Interleukin-4/interleukin-4 receptor gene polymorphisms in hand osteoarthritis.
20208004 2010 Coordinate interaction between IL-13 and epithelial differentiation cluster genes in eosinophilic esophagitis.
20207250 2010 The association of innate immune response gene polymorphisms and puerperal group A streptococcal sepsis.
20198887 2010 [Association of interleukin-13 gene polymorphisms with atopic bronchial asthma].
20194818 2010 Prenatal maternal stress and cord blood innate and adaptive cytokine responses in an inner-city cohort.
20177070 2010 Epithelial myosin light chain kinase activation induces mucosal interleukin-13 expression to alter tight junction ion selectivity.
20159242 2010 Genome-wide association study of asthma identifies RAD50-IL13 and HLA-DR/DQ regions.
20140262 2010 Maternal and fetal genetic associations of PTGER3 and PON1 with preterm birth.
20107485 2010 mu-Opioid receptor is induced by IL-13 within lymph nodes from patients with Sézary syndrome.
20093796 2009 Activation of signal transducer and activator of transcription factor 1 by interleukins-13 and -4 in cultured human bronchial smooth muscle cells.
20085599 2009 A multi-centre study of candidate genes for wheeze and allergy: the International Study of Asthma and Allergies in Childhood Phase 2.
20081054 2010 Interleukin-13-induced mucous metaplasia increases susceptibility of human airway epithelium to rhinovirus infection.
20051514 2010 NF45 and NF90 regulate HS4-dependent interleukin-13 transcription in T cells.
20041150 2009 Missense mutations in the MEFV gene are associated with fibromyalgia syndrome and correlate with elevated IL-1beta plasma levels.
19995275 2009 Il13 promoter (-1055) polymorphisms associated with chronic obstructive pulmonary disease in Taiwanese.
19968504 2010 Overexpression of IL-13 in patients with bladder cancer.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19933216 2010 The COPD genetic association compendium: a comprehensive online database of COPD genetic associations.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19910508 2009 Conjunctival interleukin-13 expression in mucous membrane pemphigoid and functional effects of interleukin-13 on conjunctival fibroblasts in vitro.
19862939 2009 Single-nucleotide polymorphisms in genes predisposing to asthma in children of Chinese Han nationality.
19840389 2009 Identification of a haplotype block in the 5q31 cytokine gene cluster associated with the susceptibility to severe malaria.
19796199 2010 Polymorphisms in IL13 pathway genes in asthma and chronic obstructive pulmonary disease.
19789190 2009 A gene-based risk score for lung cancer susceptibility in smokers and ex-smokers.
19773451 2009 Role of inflammation gene polymorphisms on pain severity in lung cancer patients.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19772762 Several interleukin-4 and interleukin-13 gene single nucleotide polymorphisms among Chinese asthmatic patients.
19759281 2009 Modulation of human plasmacytoid DC function by IFN-lambda1 (IL-29).
19739097 2009 SUMF2 interacts with interleukin-13 and inhibits interleukin-13 secretion in bronchial smooth muscle cells.
19729601 2009 Candidate gene polymorphisms for ischemic stroke.
19726720 2009 Alternatively activated macrophages engage in homotypic and heterotypic interactions through IL-4 and polyamine-induced E-cadherin/catenin complexes.
19706623 2009 An allergy-associated polymorphism in a novel regulatory element enhances IL13 expression.
19706316 2010 Differential modulation of CCR5-tropic human immunodeficiency virus-1 transfer from macrophages towards T cells under interleukin-4/interleukin-13 microenvironment.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19674346 2009 Polymorphisms in inflammation genes, tobacco smoke and furred pets and wheeze in children.
19659863 2009 Keratinocytes treated with peptidoglycan from Staphylococcus aureus produce vascular endothelial growth factor, and its expression is amplified by the subsequent production of interleukin-13.
19654941 2009 Interleukin-13 and its receptors in idiopathic interstitial pneumonia: clinical implications for lung function.
19635933 2010 Interleukin-13 regulates secretion of the tumor growth factor-{beta} superfamily cytokine activin A in allergic airway inflammation.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19602238 2009 IL-13 expression by blood T cells and not eosinophils is increased in asthma compared to non-asthmatic eosinophilic bronchitis.
19586918 2009 Distinct structural requirements for interleukin-4 (IL-4) and IL-13 binding to the shared IL-13 receptor facilitate cellular tuning of cytokine responsiveness.
19578876 2009 The ERAP2 gene is associated with preeclampsia in Australian and Norwegian populations.
19575932 2009 [Correlation of IL-4 and IL-13 gene polymorphisms with asthma and total serum IgE levels].
19573080 2009 Common genetic variants in candidate genes and risk of familial lymphoid malignancies.
19559392 2009 A candidate gene association study of 77 polymorphisms in migraine.
19555572 2009 [Single nucleotide polymorphism in asthma predisposing genes in children in Shanghai].
19554022 2009 Association between IL13 polymorphisms and psoriatic arthritis is modified by smoking.
19536153 2009 Sex-specific effect of IL9 polymorphisms on lung function and polysensitization.
19527514 2009 Racial disparity in pathophysiologic pathways of preterm birth based on genetic variants.
19515749 2009 Favorable impact of the interleukin-4 receptor allelic variant I75 on the survival of diffuse large B-cell lymphoma patients demonstrated in a large prospective clinical trial.
19507063 2009 Genetic copy number alterations and IL-13 expression differences in papillary thyroid cancers and benign nodules.
19505916 2009 Cytokine and cytokine receptor single-nucleotide polymorphisms predict risk for non-small cell lung cancer among women.
19487697 2009 House dust mite allergen Der f 2-induced phospholipase D1 activation is critical for the production of interleukin-13 through activating transcription factor-2 activation in human bronchial epithelial cells.
19479237 2009 Phenotype-genotype interactions on renal function in type 2 diabetes: an analysis using structural equation modelling.
19470259 2009 [Correlation of lymphoblastic PPAR-gamma mRNA expression with plasma IL-13 contents in children with acute idiopathic thrombocytopenic purpura].
19420105 2009 A candidate gene approach to genetic prognostic factors of IgA nephropathy--a result of Polymorphism REsearch to DIstinguish genetic factors Contributing To progression of IgA Nephropathy (PREDICT-IgAN).
19417211 2009 EBV Zta protein induces the expression of interleukin-13, promoting the proliferation of EBV-infected B cells and lymphoblastoid cell lines.
19333920 2009 Effector CD8+ T cells in systemic sclerosis patients produce abnormally high levels of interleukin-13 associated with increased skin fibrosis.
19332998 2009 Association of interleukin-13/-4 and toll-like receptor 10 with preterm births.
19326508 2009 Asthma and ethnic minorities: socioeconomic status and beyond.
19264973 2009 Assessing the reproducibility of asthma candidate gene associations, using genome-wide data.
19263529 2009 Genetic risk factors in recurrent venous thromboembolism: A multilocus, population-based, prospective approach.
19262574 2009 Genome-wide association scan yields new insights into the immunopathogenesis of psoriasis.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19254294 2009 Contribution of functional variation in the IL13 gene to allergy, hay fever and asthma in the NSHD longitudinal 1946 birth cohort.
19251840 2009 Th2 cytokine-induced upregulation of 11beta-hydroxysteroid dehydrogenase-1 facilitates glucocorticoid suppression of proasthmatic airway smooth muscle function.
19247692 2009 Analyses of associations with asthma in four asthma population samples from Canada and Australia.
19231232 2009 IL-13 induces translocation of NF-kappaB in cultured human bronchial smooth muscle cells.
19225544 2009 Variation in the lymphotoxin-alpha/tumor necrosis factor locus modifies risk of erythema nodosum in sarcoidosis.
19222422 2009 A haplotype in the inducible T-cell tyrosine kinase is a risk factor for seasonal allergic rhinitis.
19220774 2009 IL13 variants are associated with total serum IgE and early sensitization to food allergens in children with atopic dermatitis.
19192232 2009 T-cell cytokine profiles are altered in childhood asthma exacerbation.
19190772 2009 Association of the gene polymorphisms IFN-gamma +874, IL-13 -1055 and IL-4 -590 with patterns of reinfection with Schistosoma mansoni.
19178408 2009 Interleukin-13 promoter gene polymorphism -1112C/T is associated with the systemic form of mastocytosis.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19169254 2009 Genome-wide scan reveals association of psoriasis with IL-23 and NF-kappaB pathways.
19141347 2009 Biomarkers for nononcologic gastrointestinal diseases.
19131662 2009 A meta-analysis of candidate gene polymorphisms and ischemic stroke in 6 study populations: association of lymphotoxin-alpha in nonhypertensive patients.
19131452 2009 Genetic association study for RSV bronchiolitis in infancy at the 5q31 cytokine cluster.
19122650 2009 Increased hyaluronan production and decreased E-cadherin expression by cytokine-stimulated keratinocytes lead to spongiosis formation.
19116009 2008 IFN-gamma, IL-4 and IL-13 modulate responsiveness of human airway smooth muscle cells to IL-13.
19109239 2008 Type I IL-4Rs selectively activate IRS-2 to induce target gene expression in macrophages.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19019335 2009 Spontaneous preterm birth in African Americans is associated with infection and inflammatory response gene variants.
19011907 2009 Polymorphisms in interleukin-4-related genes in patients with minimal change nephrotic syndrome.
19005922 2008 Interleukin-9 and -13 inhibit spontaneous and corticosteroid induced apoptosis of normal airway epithelial cells.
18989750 2009 Interleukin13 haplotypes and susceptibility of Iranian women to breast cancer.
18974840 2008 Identification of novel single nucleotide polymorphisms in inflammatory genes as risk factors associated with trachomatous trichiasis.
18949100 2008 Low HDL cholesterol, smoking and IL-13 R130Q polymorphism are associated with myocardial infarction in Greek Cypriot males. A pilot study.
18941246 2008 Reversal of thymic stromal lymphopoietin-induced airway inflammation through inhibition of Th2 responses.
18931892 2009 An association study of 13 SNPs from seven candidate genes with pediatric asthma and a preliminary study for genetic testing by multiple variants in Taiwanese population.
18931077 2008 Stimulation of interleukin-13 expression by human T-cell leukemia virus type 1 oncoprotein Tax via a dually active promoter element responsive to NF-kappaB and NFAT.
18927306 2008 Polymorphisms in the interleukin-4 receptor gene are associated with better survival in patients with glioblastoma.
18849614 2009 Analysis of polymorphisms in olive pollen allergy: IL13, IL4RA, IL5 and ADRB2 genes.
18818748 2008 Preterm birth in Caucasians is associated with coagulation and inflammation pathway gene variants.
18815020 2009 Genetic variation of IL13 as a risk factor of reduced lung function in children and adolescents: a cross-sectional population-based study in Korea.
18712166 Regulation of matrix metalloproteinases (MMP)-2/-9 expression in eosinophilic chronic rhinosinusitis--cell culture by interleukin-5 and -13?
18699941 2008 Induced sputum and bronchial mucosal expression of interleukin-13 is not increased in chronic obstructive pulmonary disease.
18691306 2008 Study of gene-gene interactions for endophenotypic quantitative traits in Chinese asthmatic children.
18688040 2009 Interleukin-13 augments bronchial smooth muscle contractility with an up-regulation of RhoA protein.
18676870 2008 Variants in inflammation genes and the risk of biliary tract cancers and stones: a population-based study in China.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18674658 2008 Genetic regulation of cervical antiinflammatory cytokine concentrations during pregnancy.
18633131 2008 Host immune gene polymorphisms in combination with clinical and demographic factors predict late survival in diffuse large B-cell lymphoma patients in the pre-rituximab era.
18625055 2008 Lack of association or interactions between the IL-4, IL-4Ralpha and IL-13 genes, and rheumatoid arthritis.
18551035 2008 Association of IL-13 polymorphisms with leukotriene receptor antagonist drug responsiveness in Korean children with exercise-induced bronchoconstriction.
18545091 2008 Association of cytokine gene polymorphisms with rate of decline in lung function.
18506597 2009 Lack of association between interleukin-13 gene polymorphisms (-1055 C/T and +2044 G/A) in Iranian patients with lung cancer.
18497474 2008 STAT6 mediates apoptosis of human coronary arterial endothelial cells by interleukin-13.
18441098 2008 Increased transcription of cytokine genes in human lung epithelial cells through activation of a TRPM8 variant by cold temperatures.
18441092 2008 MAP kinases mediate interleukin-13 effects on calcium signaling in human airway smooth muscle cells.
18418228 2008 Th2-dependent cytokine release in patients treated with coronary angioplasty.
18417506 2008 Interleukin 13, CD14, pet and tobacco smoke influence atopy in three Dutch cohorts: the allergenic study.
18410779 2008 Environmental tobacco smoke and interleukin 4 polymorphism (C-589T) gene: environment interaction increases risk of wheezing in African-American infants.
18410415 2008 Polymorphisms in the interleukin 13 and GATA binding protein 3 genes and the development of eczema during childhood.
18403443 2008 Interleukin-4 activates large-conductance, calcium-activated potassium (BKCa) channels in human airway smooth muscle cells.
18395486 2008 Hyper-responsiveness of IPF/UIP fibroblasts: interplay between TGFbeta1, IL-13 and CCL2.
18385759 2008 Th2 cytokines act on S100/A11 to downregulate keratinocyte differentiation.
18348727 2008 IL-13 induces a bronchial epithelial phenotype that is profibrotic.
18341619 2008 Combined effect of tumour necrosis factor-alpha and interleukin-13 polymorphisms on bronchial hyperresponsiveness in Korean children with asthma.
18312531 2008 Relation between serum IL-4, IL-13 and IFN-gamma levels and recurrence of wheezing episodes in infants with acute bronchiolitis.
18296848 2008 IL-13 attenuates vascular tube formation via JAK2-STAT6 pathway.
18296657 2008 Association of CTLA-4 and IL-13 gene polymorphisms with Graves' disease and ophthalmopathy in Chinese children.
18273035 2008 A STAT6 gene polymorphism is associated with high infection levels in urinary schistosomiasis.
18263811 2008 Association of combined IL-13/IL-4R signaling pathway gene polymorphism with Stevens-Johnson syndrome accompanied by ocular surface complications.
18251702 2008 Interleukin-4 and interleukin-13 stimulate the osteoclast inhibitor osteoprotegerin by human endothelial cells through the STAT6 pathway.
18243827 2008 Interleukin-13 mucosal production in Helicobacter pylori-related gastric diseases.
18243101 2008 Molecular and structural basis of cytokine receptor pleiotropy in the interleukin-4/13 system.
18204280 2008 Interleukin-4 and interleukin-13 enhance human bronchial smooth muscle cell proliferation.
18186920 2008 IL13 gene polymorphisms modify the effect of exposure to tobacco smoke on persistent wheeze and asthma in childhood, a longitudinal study.
18073124 2007 IL-13 involvement in eosinophilic esophagitis: transcriptome analysis and reversibility with glucocorticoids.
18056382 2007 Analysis of the 5q31 33 locus shows an association between single nucleotide polymorphism variants in the IL-5 gene and symptomatic infection with the human blood fluke, Schistosoma japonicum.
18037162 2008 Patterns of GATA3 and IL13 gene polymorphisms associated with childhood rhinitis and atopy in a birth cohort.
18028994 2008 The glucocorticoid receptor beta isoform can mediate transcriptional repression by recruiting histone deacetylases.
18006935 2007 An international case-control study of interleukin-4Ralpha, interleukin-13, and cyclooxygenase-2 polymorphisms and glioblastoma risk.
17911623 2007 IL-13 induces disease-promoting type 2 cytokines, alternatively activated macrophages and allergic inflammation during pulmonary infection of mice with Cryptococcus neoformans.
17883727 2007 Association between candidate genes and lung function growth in Chinese asthmatic children.
17868461 2007 Inverse association of plasma IL-13 and inflammatory chemokines with lung function impairment in stable COPD: a cross-sectional cohort study.
17717322 2008 Secretion of IL-13 by airway epithelial cells enhances epithelial repair via HB-EGF.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17644317 2007 Complex regulation of S100A8 by IL-17, dexamethasone, IL-4 and IL-13 in HaCat cells (human keratinocyte cell line).
17623648 2007 Soluble ST2 blocks interleukin-33 signaling in allergic airway inflammation.
17615386 2007 IL13 promoter polymorphism 1112C/T modulates the adverse effect of tobacco smoking on lung function.
17603012 2007 Endogenous metalloprotease solubilizes IL-13 receptor alpha2 in airway epithelial cells.
17597813 2008 Modulation of keratinocyte-derived MMP-9 by IL-13: a possible role for the pathogenesis of epidermal inflammation.
17563406 2007 Association of the expression of IL-4 and IL-13 genes, IL-4 and IgE serum levels with allergic asthma.
17561245 2007 Polymorphisms in IL13, total IgE, eosinophilia, and asthma exacerbations in childhood.
17560640 2007 Effect of IL-13 receptor alpha2 levels on the biological activity of IL-13 variant R110Q.
17548690 2007 Allergy-related polymorphisms influence glioma status and serum IgE levels.
17543424 2007 [Interleukin 13 and interleukin 13 receptor involvement in systemic sclerosis].
17517104 2007 Immunoreactivity profile of peripheral blood mononuclear cells from patients with ragweed-induced allergic rhinitis.
17451413 2007 Single-nucleotide polymorphisms in the IL-4 and IL-13 promoter region in aggressive periodontitis.
17418380 2007 Mechanisms of tissue inhibitor of metalloproteinase 1 augmentation by IL-13 on TGF-beta 1-stimulated primary human fibroblasts.
17388919 2007 Cytokine gene polymorphisms in Chinese patients with psoriasis.
17355643 2007 Frequencies of single nucleotide polymorphisms in genes regulating inflammatory responses in a community-based population.
17347445 2007 Measurement of IL-13-induced iNOS-derived gas phase nitric oxide in human bronchial epithelial cells.
17346294 2007 IL13 gene polymorphism association with cord serum immunoglobulin E.
17313976 2007 IL-13 genetic polymorphism identifies children with late wheezing after respiratory syncytial virus infection.
17303923 2007 Association between the polymorphisms of IL-4 gene promoter (-590C>T), IL-13 coding region (R130Q) and IL-16 gene promoter (-295T>C) and allergic asthma.
17303794 2007 Ethnicity-specific gene-gene interaction between IL-13 and IL-4Ralpha among African Americans with asthma.
17291854 2007 Parental smoking impairs vaccine responses in children with atopic genotypes.
17287067 2007 Interleukin-13 stimulates the secretion of vascular endothelial growth factor and soluble fms-like tyrosine kinase-1 by human oviductal epithelial cells.
17284225 2007 Genetic diversity of the IL-4, IL-4 receptor and IL-13 loci in mestizos in the general population and in patients with asthma from three subpopulations in Mexico.
17264150 2007 IL-13 mediates the recruitment of reserve cells for fusion during IGF-1-induced hypertrophy of human myotubes.
17251453 2007 Genetic polymorphisms in the promoter of the interferon gamma receptor 1 gene are associated with atopic cataracts.
17235327 2007 Regulation of IL-13 receptors in human keratinocytes.
17209513 2006 No potential role of genetic polymorphisms for IL-4, IL-13 and IL-4 receptor in respiratory allergy: a study in adults working at social welfare facilities in Korea.
17201240 2006 Diisocyanate asthma and gene-environment interactions with IL4RA, CD-14, and IL-13 genes.
17183946 2006 [The significance of IL-13 gene +2044G/A mutation in patients with inflammatory bowel disease].
17182591 2007 IL-13 is pivotal in the fibro-obliterative process of bronchiolitis obliterans syndrome.
17142763 2006 Th2 cell-selective enhancement of human IL13 transcription by IL13-1112C>T, a polymorphism associated with allergic inflammation.
17097743 2007 Increased IL-13-producing T cells in ALS: positive correlations with disease severity and progression rate.
17091279 2007 Polymorphisms in the IL-13 and IL-4 receptor alpha genes and allergic rhinitis.
17090525 2007 The human IL-13 locus in neonatal CD4+ T cells is refractory to the acquisition of a repressive chromatin architecture.
17082655 2006 Porcine endothelial cells and iliac arteries transduced with AdenoIL-4 are intrinsically protected, through Akt activation, against immediate injury caused by human complement.
17016624 2006 Association of phosphodiesterase 4D gene polymorphisms with chronic obstructive pulmonary disease: relationship to interleukin 13 gene polymorphism.
17006604 2006 Gene-gene interaction between IL-13 and IL-13Ralpha1 is associated with total IgE in Korean children with atopic asthma.
17001290 2006 Gene-gene interactions of IL13 and IL4RA variants in immediate allergic reactions to betalactam antibiotics.
16987060 2006 Differential regulation of CXCR4 and CCR5 expression by interleukin (IL)-4 and IL-13 is associated with inhibition of chemotaxis and human immunodeficiency Virus (HIV) type 1 replication but not HIV entry into human monocytes.
16961803 2006 Polymorphisms in cytokine genes and risk of Helicobacter pylori infection among Jamaican children.
16951338 2006 Monocyte 15-lipoxygenase expression is regulated by a novel cytosolic signaling complex with protein kinase C delta and tyrosine-phosphorylated Stat3.
16918506 2006 Mast cells express IL-13R alpha 1: IL-13 promotes human lung mast cell proliferation and Fc epsilon RI expression.
16914241 2007 Impact of genetic variants in IL-4, IL-4 RA and IL-13 on the anti-pneumococcal antibody response.
16867043 2006 IL-10 promoter and IL4-Ralpha gene SNPs are associated with immediate beta-lactam allergy in atopic women.
16849505 2006 Role of 5-lipoxygenase in IL-13-induced pulmonary inflammation and remodeling.
16832637 2006 Evaluation of interleukin 13 polymorphisms in systemic sclerosis.
16751012 2006 Selective downregulation of prostaglandin E2-related pathways by the Th2 cytokine IL-13.
16750991 2006 Association of IL13 with total IgE: evidence against an inverse association of atopy and diabetes.
16702372 2006 Associations of classic Kaposi sarcoma with common variants in genes that modulate host immunity.
16681592 2006 No association of cytokine gene polymorphisms in Chinese patients with atopic dermatitis.
16522370 2006 Regulation of interleukin IL-4, IL-13, IL-10, and their downstream components in lipopolysaccharide-exposed rat lungs. Comparison of the constitutive expression between rats and humans.
16493441 2006 Role of interferon-gamma gene polymorphisms in susceptibility to IgA nephropathy: a family-based association study.
16461126 2006 IL-4/IL-13 pathway genetics strongly influence serum IgE levels and childhood asthma.
16428771 2006 Cytokine production associated with periportal fibrosis during chronic schistosomiasis mansoni in humans.
16403098 2006 Cytokine gene polymorphisms in bullous pemphigoid in a Chinese population.
16388492 2006 Association between severe respiratory syncytial virus infection and IL13/IL4 haplotypes.
16387595 2006 Gene-gene interactions for asthma and plasma total IgE concentration in Chinese children.
16327802 2006 IL-13 signaling through the IL-13alpha2 receptor is involved in induction of TGF-beta1 production and fibrosis.
16315031 2005 Polymorphisms of IL-13 and IL-4-IL-13-SNPs in patients with penicillin allergies.
16303333 Simultaneous aberrations in Mphi and T cell function adversely affect trauma patients' clinical outcome: a possible faulty IL-13 feedback loop.
16275384 2005 Allergic dysregulation and hyperimmunoglobulinemia E in Foxp3 mutant mice.
16272823 2006 Lack of association between the IL13 variant Arg110Gln and susceptibility to cedar pollinosis in a Japanese population.
16236836 2005 Interleukin-13 and interleukin-5 in induced sputum of eosinophilic bronchitis: comparison with asthma.
16210662 2005 IL-13 acutely augments HIV-specific and recall responses from HIV-1-infected subjects in vitro by modulating monocytes.
16200868 2004 [Correlation of interleukin-13 gene - 1112c/T polymorphism with asthma and total plasma IgE levels].
16195814 2005 Association study between the IL4, IL13, IRF1 and UGRP1 genes in chromosomal 5q31 region and Chinese Graves' disease.
16166103 2006 Th2 cytokine genotypes are associated with a milder form of primary Sjogren's syndrome.
16133987 2005 Elevated allergen-induced IL-13 secretion predicts IgE elevation in children ages 2-5 years.
16101942 2005 CT genotype of promotor polymorphism C159T in the CD14 gene is associated with lower prevalence of atopic dermatitis and lower IL-13 production.
16046318 2005 Association of non-HLA genes with type 1 diabetes autoimmunity.
16034134 2005 IL-4 and IL-13 induce protection of porcine endothelial cells from killing by human complement and from apoptosis through activation of a phosphatidylinositide 3-kinase/Akt pathway.
16024972 Association of IL-13, RANTES, and leukotriene C4 synthase gene promoter polymorphisms with asthma and/or atopy in African Americans.
16024651 2005 Polymorphisms associated with asthma are inversely related to glioblastoma multiforme.
16001979 2005 IL-4 increases type 2, but not type 1, cytokine production in CD8+ T cells from mild atopic asthmatics.
15969687 2005 Relationships between specific serum IgE, cytokines and polymorphisms in the IL-4, IL-4Ralpha in patients with penicillins allergy.
15951665 2005 Risk of small-for-gestational age is associated with common anti-inflammatory cytokine polymorphisms.
15919378 IL-21 effects on human IgE production in response to IL-4 or IL-13.
15904474 2005 Interleukin-2 gene polymorphisms associated with increased risk of gastric atrophy from Helicobacter pylori infection.
15879126 2005 Analysis of the 5q31-q33 locus shows an association between IL13-1055C/T IL-13-591A/G polymorphisms and Schistosoma haematobium infections.
15870068 2005 Characterization of the interaction between interleukin-13 and interleukin-13 receptors.
15869882 2005 Gene expression alterations of human peripheral blood monocytes induced by medium-term treatment with the TH2-cytokines interleukin-4 and -13.
15845862 2005 Interleukin-10-secreting "regulatory" T cells induced by glucocorticoids and beta2-agonists.
15820084 2005 Association of gene polymorphisms of tumour necrosis factor-alpha and interleukin-13 with chronic obstructive pulmonary disease in Han nationality in Beijing.
15731584 2005 Genetic predisposition to latex allergy: role of interleukin 13 and interleukin 18.
15728267 2005 Interleukin-13 genetic polymorphisms in Singapore Chinese children correlate with long-term outcome of minimal-change disease.
15713213 2005 Chromosome 5q candidate genes in coeliac disease: genetic variation at IL4, IL5, IL9, IL13, IL17B and NR3C1.
15711639 2005 IL-13 R130Q, a common variant associated with allergy and asthma, enhances effector mechanisms essential for human allergic inflammation.
15699166 2005 IL-11 receptor alpha in the pathogenesis of IL-13-induced inflammation and remodeling.
15687724 Polymorphism of the interleukin-4, interleukin-13, and signal transducer and activator of transcription 6 genes in Indonesian children with minimal change nephrotic syndrome.
15661077 2005 The effect of IL-13 and IL-13R130Q, a naturally occurring IL-13 polymorphism, on the gene expression of human airway smooth muscle cells.
15660293 2005 No evidence of association or interaction between the IL4RA, IL4, and IL13 genes in type 1 diabetes.
15642470 2005 Optimization of expression and purification of two biologically active chimeric fusion proteins that consist of human interleukin-13 and Pseudomonas exotoxin in Escherichia coli.
15634905 2005 Transcriptional profiling reveals complex regulation of the monocyte IL-1 beta system by IL-13.
15596681 2004 Polymorphisms of IL4, IL13, and ADRB2 genes in COPD.
15528258 2005 Interleukin-4- and -13-induced hypercontractility of human intestinal muscle cells-implication for motility changes in Crohn's disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15488706 2004 Serological detection of eotaxin, IL-4, IL-13, IFN-gamma, MIP-1alpha, TARC and IP-10 in chronic autoimmune urticaria and chronic idiopathic urticaria.
15483090 2005 Interleukin-13 gene polymorphisms confer the susceptibility of Japanese populations to Graves' disease.
15474066 2004 Cultured human endometrial epithelial cells produce thymus and activation-regulated chemokine with stimulation of interleukin-4 and interleukin-13.
15388001 2004 [The study of interleukin-13 gene promoter polymorphism in patients with chronic obstructive pulmonary disease].
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15361241 2004 Interleukin-13 in the skin and interferon-gamma in the liver are key players in immune protection in human schistosomiasis.
15356573 2004 Synthesis of IL-13 by human B lymphocytes: regulation and role in IgE production.
15356556 2004 Functional effect of the R110Q IL13 genetic variant alone and in combination with IL4RA genetic variants.
15315330 2004 Association between IL-13 gene polymorphism and asthma in Han nationality in Hubei Chinese population.
15308043 2004 [Study on the correlation of interleukin-13 polymorphism and susceptibility to chronic obstructive pulmonary disease in Chinese Han population].
15229217 2004 Role of NFAT proteins in IL13 gene transcription in mast cells.
15191916 2004 Molecular regulation of interleukin-13 and monocyte chemoattractant protein-1 expression in human mast cells by interleukin-1beta.
15187156 2004 Adenosine-activated mast cells induce IgE synthesis by B lymphocytes: an A2B-mediated process involving Th2 cytokines IL-4 and IL-13 with implications for asthma.
15163899 2004 Th2 cytokines IL-4 and IL-13 downregulate paxillin expression in bronchial airway epithelial cells.
15163701 2004 Interleukin-13 overexpression by tax transactivation: a potential autocrine stimulus in human T-cell leukemia virus-infected lymphocytes.
15155645 2004 Association of type 2 cytokines with hepatic fibrosis in human Schistosoma mansoni infection.
15155567 2004 IL-13 and IL-1beta promote lung fibroblast growth through coordinated up-regulation of PDGF-AA and PDGF-Ralpha.
15146247 2004 Nonclassical CD1d-restricted NK T cells that produce IL-13 characterize an atypical Th2 response in ulcerative colitis.
15014952 2004 Relative importance of IL-4 and IL-13 in lesional skin of atopic dermatitis.
15007355 2004 Genetic variation in immunoregulatory pathways and atopic phenotypes in infancy.
15007352 2004 Associations between specific serum IgE response and 6 variants within the genes IL4, IL13, and IL4RA in German children: the German Multicenter Atopy Study.
15005726 2004 Association of polymorphisms in Th1, Th2 cytokine genes with hayfever and atopy in a subsample of EPIC-Heidelberg.
15004182 2004 IL-4 and IL-13 up-regulate intestinal trefoil factor expression: requirement for STAT6 and de novo protein synthesis.
14984938 2004 Differential expression of interleukins IL-13 and IL-15 in normal ovarian tissue and ovarian carcinomas.
14983029 2004 Analysis of intergenic transcription in the human IL-4/IL-13 gene cluster.
14764428 2004 Modulation of calcium signaling by interleukin-13 in human airway smooth muscle: role of CD38/cyclic adenosine diphosphate ribose pathway.
14756548 Serum IL-13 concentration response to surgical treatment in patients with laryngeal squamous cell carcinoma.
14734771 2004 Expression of CD154 (CD40 ligand) by human lung fibroblasts: differential regulation by IFN-gamma and IL-13, and implications for fibrosis.
14669230 2003 [The relationship between IL-13 gene polymorphism and the levels of serum IL-13 and serum eosinophil cation protein in asthmatic children].
14634100 2003 IL-4 and IL-13 induce SOCS-1 gene expression in A549 cells by three functional STAT6-binding motifs located upstream of the transcription initiation site.
14564352 2003 Association study of the IL13 variant Arg110Gln in atopic diseases and juvenile idiopathic arthritis.
14561191 2002 IL-4 and IL-13: their pathological roles in allergic diseases and their potential in developing new therapies.
14551608 2003 A single-nucleotide substitution from C to T at position -1055 in the IL-13 promoter is associated with protection from severe malaria in Thailand.
14512310 2004 IL-13 production by donor T cells is prognostic of acute graft-versus-host disease following unrelated donor stem cell transplantation.
14510917 2003 Interleukin-13 gene polymorphisms in patients with Graves' disease.
12944981 2003 Genomic analysis of Th1-Th2 cytokine genes in an AIDS cohort: identification of IL4 and IL10 haplotypes associated with the disease progression.
12935900 2003 MIP-T3 associates with IL-13Ralpha1 and suppresses STAT6 activation in response to IL-13 stimulation.
12928861 2003 A common IL-13 Arg130Gln single nucleotide polymorphism among Chinese atopy patients with allergic rhinitis.
12920029 2003 Activation of interleukin-13 expression in T cells from HTLV-1-infected individuals and in chronically infected cell lines.
12897746 2003 Associations between total serum IgE levels and the 6 potentially functional variants within the genes IL4, IL13, and IL4RA in German children: the German Multicenter Atopy Study.
12884288 2003 Analysis of allelic expression patterns of IL-2, IL-3, IL-4, and IL-13 in human CD4+ T cell clones.
12794003 2003 IL-13-induced changes in the goblet cell density of human bronchial epithelial cell cultures: MAP kinase and phosphatidylinositol 3-kinase regulation.
12748907 2003 Association and interaction of the IL4R, IL4, and IL13 loci with type 1 diabetes among Filipinos.
12748293 2003 Interleukin-13 induction of 15-lipoxygenase gene expression requires p38 mitogen-activated protein kinase-mediated serine 727 phosphorylation of Stat1 and Stat3.
12704784 2003 IL-13 regulates vascular cell adhesion molecule-1 expression in human osteoblasts.
12682264 2003 Up-regulation of cysteinyl leukotriene 1 receptor by IL-13 enables human lung fibroblasts to respond to leukotriene C4 and produce eotaxin.
12654630 2003 CC chemokine receptor 3 mobilizes to the surface of human mast cells and potentiates immunoglobulin E-dependent generation of interleukin 13.
12594065 2003 Polymorphisms in the IL13, IL13RA1, and IL4RA genes and rate of decline in lung function in smokers.
12548511 2003 Are cytokine gene polymorphisms related to in vitro cytokine production profiles?
12525574 2003 Basophils express a type 2 cytokine profile on exposure to proteases from helminths and house dust mites.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12441140 2002 IL-4, but not IL-13, modulates TARC (thymus and activation-regulated chemokine)/CCL17 and IP-10 (interferon-induced protein of 10kDA)/CXCL10 release by TNF-alpha and IFN-gamma in HaCaT cell line.
12424628 2002 Chronic obstructive pulmonary disease is associated with the -1055 IL-13 promoter polymorphism.
12413765 2002 Interleukin-13 gene polymorphism G4257A is associated with atopic dermatitis in Japanese patients.
12396617 2002 Heme oxygenase 1 mediates the immunomodulatory and antiapoptotic effects of interleukin 13 gene therapy in vivo and in vitro.
12377947 2002 Human eosinophils express and release IL-13 following CD28-dependent activation.
12370400 2002 TGF-beta and IL-13 synergistically increase eotaxin-1 production in human airway fibroblasts.
12370393 2002 HIV-1 envelope gp41 peptides promote migration of human Fc epsilon RI+ cells and inhibit IL-13 synthesis through interaction with formyl peptide receptors.
12223527 2002 IL-13 signal transduction in human monocytes: phosphorylation of receptor components, association with Jaks, and phosphorylation/activation of Stats.
12207328 2002 Human lung myofibroblasts as effectors of the inflammatory process: the common receptor gamma chain is induced by Th2 cytokines, and CD40 ligand is induced by lipopolysaccharide, thrombin and TNF-alpha.
12189139 2002 Alanine-scanning mutagenesis of alpha-helix D segment of interleukin-13 reveals new functionally important residues of the cytokine.
12165514 2002 DNA methylation changes at human Th2 cytokine genes coincide with DNase I hypersensitive site formation during CD4(+) T cell differentiation.
12163193 2002 Increased IL-13 but not IL-5 production by CD4-positive T cells and CD8-positive T cells in multiple sclerosis during relapse phase.
12152987 2002 The role of interleukin 13 in classical Hodgkin lymphoma.
12145428 2002 T cells and mast cells as a major source of interleukin-13 in atopic dermatitis.
12097410 2002 Eosinophils express functional IL-13 in eosinophilic inflammatory diseases.
12089714 2002 Cytokine gene polymorphisms and acute human liver graft rejection.
11980568 2002 Type I IgE receptor, interleukin 4 receptor and interleukin 13 polymorphisms in children with nephrotic syndrome.
11940068 2002 Lack of association between a polymorphism in the interleukin-13 gene and total serum immunoglobulin E level among nuclear families in Costa Rica.
11830476 2002 Expression of type 1 (interferon gamma) and type 2 (interleukin-13, interleukin-5) cytokines at distinct stages of natural killer cell differentiation from progenitor cells.
11786536 2002 A novel mechanism by which interferon-gamma can regulate interleukin (IL)-13 responses. Evidence for intracellular stores of IL-13 receptor alpha -2 and their rapid mobilization by interferon-gamma.
11709756 2002 Gene-gene interaction in asthma: IL4RA and IL13 in a Dutch population with asthma.
11678850 2001 A polymorphism in the coding region of interleukin-13 gene is associated with atopy but not asthma in Chinese children.
11588017 2001 Identification and association of polymorphisms in the interleukin-13 gene with asthma and atopy in a Dutch population.
11419948 2001 Solution structure of human IL-13 and implication for receptor binding.
11396683 2000 Mechanisms of IgE elevation in HIV-1 infection.
11278629 2001 Characterization of a powerful high affinity antagonist that inhibits biological activities of human interleukin-13.
11197307 1999 An IL-13 promoter polymorphism associated with increased risk of allergic asthma.
11149986 2001 Dysregulation of the IgE/Fc epsilon RI network in HIV-1 infection.
11003391 2000 Characterization of the mouse interleukin-13 receptor alpha1 gene.
10753117 2000 Identification of a coordinate regulator of interleukins 4, 13, and 5 by cross-species sequence comparisons.
10725748 2000 Induction of functional IL-8 receptors by IL-4 and IL-13 in human monocytes.
10699178 2000 Genetic variants of IL-13 signalling and human asthma and atopy.
10651852 2000 A novel polymorphism in the human interleukin-13 (IL-13) promoter.
10227975 1999 IL-18 is a potent coinducer of IL-13 in NK and T cells: a new potential role for IL-18 in modulating the immune response.
9856950 1998 Requirement for IL-13 independently of IL-4 in experimental asthma.
9856949 1998 Interleukin-13: central mediator of allergic asthma.
9177784 1997 Chromosome mapping and expression of the human interleukin-13 receptor.
9139718 1997 Activation of phosphatidylinositol 3-kinase by interleukin-13. An inhibitory signal for inducible nitric-oxide synthase expression in epithelial cell line HT-29.
8605348 1996 Coexpression of the interleukin-13 and interleukin-4 genes correlates with their physical linkage in the cytokine gene cluster on human chromosome 5q23-31.
8099936 1993 Structural comparison and chromosomal localization of the human and mouse IL-13 genes.
8097324 1993 Interleukin 13, a T-cell-derived cytokine that regulates human monocyte and B-cell function.
8096327 1993 Interleukin-13 is a new human lymphokine regulating inflammatory and immune responses.
7721105 1995 Tandem arrangement of human genes for interleukin-4 and interleukin-13: resemblance in their organization.
7530359 1994 Predictive modelling of the 3-D structure of interleukin-13.
7521694 1994 Regulation of endothelial and mesothelial cell function by interleukin-13: selective induction of vascular cell adhesion molecule-1 and amplification of interleukin-6 production.
1408833 1992 The selective isolation of novel cDNAs encoded by the regions surrounding the human interleukin 4 and 5 genes.