Property Summary

NCBI Gene PubMed Count 96
PubMed Score 207.06
PubTator Score 132.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -2.884 2.5e-08
tuberculosis 1.100 5.1e-07
non-small cell lung cancer -1.080 1.3e-13
active Crohn's disease 1.923 6.3e-03
ulcerative colitis 1.500 2.9e-06
interstitial cystitis 1.700 3.0e-03
psoriasis 1.600 9.8e-70

 GO Function (1)

Gene RIF (86)

PMID Text
26621740 the introduction of RNA-DNA differences into an individual's IL12RB1 mRNA repertoire is a novel determinant of IL12/23 sensitivity.
26384304 Truncated IL12rbeta1/Fc is a novel fusion protein for specific binding multiple forms of p40 subunit to exert potent anti-inflammatory effects.
25603847 Early coupled up-regulation of IL12RB1 in CD8+ central memory and effector T cells result in better clinical outcomes in liver transplant recipients.
25516297 individual variability in IL12RB1 function is introduced at the epigenetic, genomic polymorphism, and mRNA splicing levels [review]
25467645 we describe cosegregation of a heterozygous germline defect in IL12RB1 and gastric cancer development in a family with IL-12Rbeta1 deficiency
25371211 The IL-23/IL-23R/IL-12Rbeta1 complex formation does not follow the classical "site I-II-III" architectural paradigm.
25199642 SNP rs2305743 in IL12RB1 was associated with systemic sclerosis.
24997981 Strong association of rs438421 in the IL-12Rbeta1 gene with Allergic rhinitis in Chinese was demonstrated . The GG genotype of rs438421 was validated as stimulus factors to AR, while the AG genotype of rs438421 was confirmed as protective factors to AR.
24859272 Genetic variations of IL-12B, IL-12Rbeta1, IL-12Rbeta2 in Behcet's disease and VKH syndrome.
24114017 IL12Rbeta1 expression is lacking on CD8+ T and natural killer (NK) cell surface in a 33-year-old patient with Mycobacterium tilburgii infection.
23952477 IL-12Rbeta1 expression on the cell surface was negligible or absent.
23864330 A review of the molecular genetics of all known IL12RB1 mutations and variants.
23662788 Results suggest a relationship between certain TNF-alpha and IL12B polymorphisms and the short-term response to anti-TNF-alpha drugs.
23557799 Although SNPs of the IL12RB1 gene do not seem to convey some genetic predisposition for hidradenitis suppurativa, they impact considerably on the clinical phenotype of the disease.
23217179 The IL1B gene -5839C > T and IL4R 1902A > G polymorphisms and IL12RB1 -1094A/-641C and TNF -1031 T/-863A/-857 T/-308 G/-238 G haplotypes were associated with malaria susceptibility.
23024274 IL12RB1 is located on autosomal chromosome 19 at location 19p13.1 and comprises exons 1-9, 9b, and 10-17. IL12RB1 isoform 2 is distinct from isoform 1 and is derived from alternate 3' exon inclusion.
22740240 Data indicate that IL-12B gene rs3212227 CC/AC and IL-12Rbeta1 gene 378 GG/GC genotypes, which associated with decreased IL-12p40 level, may contribute to esophageal cancer susceptibility.
22504412 IL12RB1 polymorphisms may affect IL-12 and IL-23 binding and downstream effects, which are critical cytokines in the cell-mediated immune response to measles vaccine.
21689850 Our data suggest that the effect of breast-feeding on food sensitization (FS) was modified by SNPs in the IL12RB1, TLR9, and TSLP genes both individually and jointly.
20855390 autosomal recessive IL12Rbeta1 deficiency who suffered from sepsis attributable to Klebsiella pneumoniae.
20811626 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20716621 Observational study of gene-disease association. (HuGE Navigator)
20673868 Observational study of gene-disease association. (HuGE Navigator)
20639880 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20568250 Observational study of gene-disease association. (HuGE Navigator)
20525402 Observational study of gene-disease association. (HuGE Navigator)
20503287 Observational study of gene-disease association. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20452482 Observational study of gene-disease association. (HuGE Navigator)
20424473 Observational study of gene-disease association. (HuGE Navigator)
20399512 Clinical trial of gene-disease association. (HuGE Navigator)
20350312 study has shown strong associations between polymorphisms in the genes of IL12A and IL12RB1 and protection from severe malarial anemia in Kenyan children
20350312 Observational study of gene-disease association. (HuGE Navigator)
20345976 Coupled regulation of interleukin-12 receptor beta-1 of CD8+ central memory and CCR7-negative
20237496 Observational study of gene-disease association. (HuGE Navigator)
20171917 first cases in Mexico of patients with BCG disease traced to a mutation in the IL12RB1 gene, with a fatal outcome
20060272 rs438421 (IVS12+1266T/C) SNP and the haplotype CCA (rs375947, rs438421, and rs1870063) significantly associated with atopic dermatitis
20060272 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19839503 novel nonsense mutation in exon 4 results in protein deficiency and increased susceptibility to bacterial infections
19817957 Observational study of gene-disease association. (HuGE Navigator)
19773451 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
19573080 Observational study of gene-disease association. (HuGE Navigator)
19460324 A common haplotype spanning 1.45-3.51Mb was shared by all chromosomes carrying mutation 1623_1624delinsTT, an IL12RB1 mutation, which results in Mendelian Susceptibility to Mycobacterial Diseases; mutation was not detected on 100 control chromosomes.
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19249008 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19247692 Observational study of gene-disease association. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
19074885 Observational study of gene-disease association. (HuGE Navigator)
18940359 analysis of a known (c.1623_1624delGCinsTT) and a novel mutation (c.65_68delCTGC of exon2) of the Interleukin-12 Receptor-beta1 gene in a patient with a fatal case of relapsing cervical lymphadenopathy due to Mycobacterium avium [case report]
18591412 IL-12Rbeta1- and STAT-3--dependent signals play a key role in the differentiation and/or expansion of human IL-17-producing T cell populations in vivo.
18493823 IL-12Rbeta1 gene polymorphisms do not appear to be responsible for host susceptibility to nontuberculous mycobacterial lung disease in a Korean population.
18493823 Observational study of gene-disease association. (HuGE Navigator)
18478121 data indicate that genetic variants of IL12RB1confer genetic susceptibility to SARS infection, but not necessary associated with the progression of the disease in Chinese population
18478121 Observational study of gene-disease association. (HuGE Navigator)
17703412 Observational study of gene-disease association. (HuGE Navigator)
17403771 A twofold increase in the percentage of CD4-resting T cells expressing IL-12Rbeta1 and IL-18Ralpha from HIV-1-infected patients; deregulation of the IL-12 and IL-18 pathways may play a role in the immunopathogenesis of HIV-1 infection.
17392024 Observational study of gene-disease association. (HuGE Navigator)
17392024 IL12B promoter heterozygosity was associated with protection from tuberculosis in BCG-vaccinated individuals, supporting the role that IL-23, of which IL12B encodes a subunit, plays in generation of memory T cells
17284226 Observational study of gene-disease association. (HuGE Navigator)
17284226 Genetic variants of IL12RB1, at least in part, confer genetic susceptibility to TB, and are associated with the progression of the disease, in Japanese.
17236132 Observational study of gene-disease association. (HuGE Navigator)
17222831 Observational study of gene-disease association. (HuGE Navigator)
17152005 Observational study of gene-disease association. (HuGE Navigator)
16159888 Observational study of gene-disease association. (HuGE Navigator)
16159888 In individuals with the -111T/T genotype, reduced IL-12Rbeta1 expression may lead to increased Th2 cytokine production in the skin and contribute to the development of Atopic dermatitis and other subsequent allergic diseases.
16088278 Observational study of gene-disease association. (HuGE Navigator)
16084898 Interleukin-12 receptor beta 1 codon 378 gene polymorphism is not correlated with endometriosis development.
15993716 Observational study of gene-disease association. (HuGE Navigator)
15941730 Observational study of gene-disease association. (HuGE Navigator)
15243935 IL12RB1 polymorphisms might influence the risk of development of pulmonary tuberculosis in adults
15178580 surface expression of nonfunctional IL-12Rbeta1 is related to an IL12RB1 mutation
15063762 Observational study of gene-disease association. (HuGE Navigator)
15004750 Observational study of gene-disease association. (HuGE Navigator)
12743658 Observational study of gene-disease association. (HuGE Navigator)
12743658 Mutations have no association with the susceptibility to lepromatous leprosy in the Korean population.
12719941 Observational study of gene-disease association. (HuGE Navigator)
12671732 impact of amino acid variations on the three-dimensional structure of the IL-12Rbeta1 protein
12596048 Observational study of gene-disease association. (HuGE Navigator)
12596048 These data suggest that the R214-T365-R378 allele, i.e., variation in IL12RB1, contribute to tuberculosis susceptibility in the Japanese population.
12594833 Severe Mycobacterium bovis BCG infections in a large series of novel IL-12 receptor beta1 deficient patients and evidence for the existence of partial IL-12 receptor beta1 deficiency.
12496448 A splice acceptor mutation affecting exon 15 of the IL-12R beta 1 subunit gene results in complete loss of surface expression of this subunit, and impairment of memory CD4 T cells with Th1 effector function.
12020266 Observational study of gene-disease association. (HuGE Navigator)
11857344 IL-12R beta 1- and IFN-gamma R1 signals co-ordinately regulate IFN-gamma production, but only IL-12 negatively controls IL-4 production. IL-12 and IFN-gamma signals are each sufficient for IFN-gamma production but both are needed for optimal production.

AA Sequence

MEPLVTWVVPLLFLFLLSRQGAACRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPT      1 - 70
AGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYE     71 - 140
PPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQL    141 - 210
RRRQLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEV    211 - 280
TYRLQLHMLSCPCKAKATRTLHLGKMPYLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTEPVALNISVG    281 - 350
TNGTTMYWPARAQSMTYCIEWQPVGQDGGLATCSLTAPQDPDPAGMATYSWSRESGAMGQEKCYYITIFA    351 - 420
SAHPEKLTLWSTVLSTYHFGGNASAAGTPHHVSVKNHSLDSVSVDWAPSLLSTCPGVLKEYVVRCRDEDS    421 - 490
KQVSEHPVQPTETQVTLSGLRAGVAYTVQVRADTAWLRGVWSQPQRFSIEVQVSDWLIFFASLGSFLSIL    491 - 560
LVGVLGYLGLNRAARHLCPPLPTPCASSAIEFPGGKETWQWINPVDFQEEASLQEALVVEMSWDKGERTE    561 - 630
PLEKTELPEGAPELALDTELSLEDGDRCKAKM                                          631 - 662
//

Text Mined References (99)

PMID Year Title
26621740 2015 The introduction of RNA-DNA differences underlies interindividual variation in the human IL12RB1 mRNA repertoire.
26384304 2015 A novel human truncated IL12r?1-Fc fusion protein ameliorates experimental autoimmune encephalomyelitis via specific binding of p40 to inhibit Th1 and Th17 cell differentiation.
25603847 2015 Early coupled up-regulation of interleukin-12 receptor beta-1 in CD8+ central memory and effector T cells for better clinical outcomes in liver transplant recipients.
25516297 2015 IL12R?1: the cytokine receptor that we used to know.
25467645 2015 Gastric cancer in three relatives of a patient with a biallelic IL12RB1 mutation.
25371211 2015 Non-canonical interleukin 23 receptor complex assembly: p40 protein recruits interleukin 12 receptor ?1 via site II and induces p19/interleukin 23 receptor interaction via site III.
25199642 2014 Identification of IL12RB1 as a novel systemic sclerosis susceptibility locus.
24997981 2015 Association study between interleukin-12 receptor ?1/?2 genes and allergic rhinitis in the Chinese Han population.
24859272 2014 Genetic variations of IL-12B, IL-12R?1, IL-12R?2 in Behcet's disease and VKH syndrome.
24114017 2013 IL-12R?1 deficiency and disseminated Mycobacterium tilburgii disease.
23952477 2014 Molecular analysis for patients with IL-12 receptor ?1 deficiency.
23864330 2013 IL-12R?1 deficiency: mutation update and description of the IL12RB1 variation database.
23662788 2013 The relationship between tumour necrosis factor (TNF)-? promoter and IL12B/IL-23R genes polymorphisms and the efficacy of anti-TNF-? therapy in psoriasis: a case-control study.
23557799 2013 Haplotypes of IL-12R?1 impact on the clinical phenotype of hidradenitis suppurativa.
23541324 2013 Genome-wide association study identifies TH1 pathway genes associated with lung function in asthmatic patients.
23217179 2012 IL1B, IL4R, IL12RB1 and TNF gene polymorphisms are associated with Plasmodium vivax malaria in Brazil.
23024274 2012 Inflammatory signals direct expression of human IL12RB1 into multiple distinct isoforms.
22740240 2012 Associations between polymorphisms in IL-12A, IL-12B, IL-12R?1, IL-27 gene and serum levels of IL-12p40, IL-27p28 with esophageal cancer.
22504412 2012 Replication of associations between cytokine and cytokine receptor single nucleotide polymorphisms and measles-specific adaptive immunophenotypic extremes.
21689850 2011 Gene polymorphisms, breast-feeding, and development of food sensitization in early childhood.
20855390 2010 Clinical disease caused by Klebsiella in 2 unrelated patients with interleukin 12 receptor beta1 deficiency.
20811626 2010 Genetic variants in inflammation-related genes are associated with radiation-induced toxicity following treatment for non-small cell lung cancer.
20716621 2010 Genetic polymorphisms in adaptive immunity genes and childhood acute lymphoblastic leukemia.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20639880 2010 Genome-wide meta-analyses identify three loci associated with primary biliary cirrhosis.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20568250 2010 Common single nucleotide polymorphisms in immunoregulatory genes and multiple myeloma risk among women in Connecticut.
20525402 2010 Analysis of eight genes modulating interferon gamma and human genetic susceptibility to tuberculosis: a case-control association study.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
20399512 2010 Nontuberculous mycobacterial cervicofacial lymphadenitis in children from the multicenter, randomized, controlled trial in The Netherlands: relevance of polymorphisms in candidate host immunity genes.
20350312 2010 Polymorphisms in genes of interleukin 12 and its receptors and their association with protection against severe malarial anaemia in children in western Kenya.
20345976 2010 Coupled regulation of interleukin-12 receptor beta-1 of CD8+ central memory and CCR7-negative memory T cells in an early alloimmunity in liver transplant recipients.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20171917 2010 Bacille Calmette-Guérin infection and disease with fatal outcome associated with a point mutation in the interleukin-12/interleukin-23 receptor beta-1 chain in two Mexican families.
20060272 2010 Association of single nucleotide polymorphisms in the IL-12 (IL-12A and B) and IL-12 receptor (IL-12Rbeta1 and beta2) genes and gene-gene interactions with atopic dermatitis in Koreans.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19839503 A novel mutation of the IL12RB1 gene in a child with nocardiosis, recurrent salmonellosis and neurofibromatosis type I: first case report from Thailand.
19817957 2009 Secreted protein acidic and rich in cysteine (SPARC) gene polymorphism association with hepatocellular carcinoma in Italian patients.
19773451 2009 Role of inflammation gene polymorphisms on pain severity in lung cancer patients.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19573080 2009 Common genetic variants in candidate genes and risk of familial lymphoid malignancies.
19460324 2009 A 475 years-old founder effect involving IL12RB1: a highly prevalent mutation conferring Mendelian Susceptibility to Mycobacterial Diseases in European descendants.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19249008 2009 Diverse genome-wide association studies associate the IL12/IL23 pathway with Crohn Disease.
19247692 2009 Analyses of associations with asthma in four asthma population samples from Canada and Australia.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
18940359 2008 Disseminated Mycobacterium avium infection in a patient with a novel mutation in the interleukin-12 receptor-beta1 chain.
18591412 2008 Mutations in STAT3 and IL12RB1 impair the development of human IL-17-producing T cells.
18493823 Interleukin-12 receptor beta1 polymorphisms and nontuberculous mycobacterial lung diseases.
18478121 2008 IL-12 RB1 genetic variants contribute to human susceptibility to severe acute respiratory syndrome infection among Chinese.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17403771 2007 Skewed expression and up-regulation of the IL-12 and IL-18 receptors in resting and activated CD4 T cells from HIV-1-infected patients.
17392024 2007 Association of polymorphisms in IL-12/IFN-gamma pathway genes with susceptibility to pulmonary tuberculosis in Indonesia.
17284226 2007 Association of IL12RB1 polymorphisms with susceptibility to and severity of tuberculosis in Japanese: a gene-based association analysis of 21 candidate genes.
17236132 2007 A large-scale genetic association study confirms IL12B and leads to the identification of IL23R as psoriasis-risk genes.
17222831 2007 Interleukin (IL)-12 receptor beta1 codon 378 G homozygote and allele, but not IL-1 (beta-511 promoter, 3953 exon 5, receptor antagonist), IL-2 114, IL-4-590 intron 3, IL-8 3'-UTR 2767, and IL-18 105, are associated with higher susceptibility to leiomyoma.
17152005 2007 Associations between measles vaccine immunity and single-nucleotide polymorphisms in cytokine and cytokine receptor genes.
16159888 2005 Association of the IL12RB1 promoter polymorphisms with increased risk of atopic dermatitis and other allergic phenotypes.
16088278 Lack of an association between interleukin-12 receptor beta1 polymorphisms and tuberculosis in Koreans.
16084898 2005 Interleukin-2 receptor beta (IL-2R beta)-627*C homozygote but not IL-12R beta 1 codon 378 or IL-18 105 polymorphism is associated with higher susceptibility to endometriosis.
15993716 2005 Interleukin 12 (IL12B) and interleukin 12 receptor (IL12RB1) gene polymorphisms in rheumatoid arthritis.
15941730 2005 Interleukin 12 (IL12B), interleukin 12 receptor (IL12RB1) and interleukin 23 (IL23A) gene polymorphism in systemic lupus erythematosus.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15243935 2004 Association of IL12RB1 polymorphisms with pulmonary tuberculosis in adults in Morocco.
15178580 2004 A novel form of complete IL-12/IL-23 receptor beta1 deficiency with cell surface-expressed nonfunctional receptors.
15114670 2004 Commensal Gram-negative bacteria prime human dendritic cells for enhanced IL-23 and IL-27 expression and enhanced Th1 development.
15063762 2004 Genetic variations in humans associated with differences in the course of hepatitis C.
15057824 2004 The DNA sequence and biology of human chromosome 19.
15004750 2004 Association between IFNA genotype and the risk of sarcoidosis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14635048 2003 IL-12 receptor deficiency revisited: IL-23-mediated signaling is also impaired in human genetic IL-12 receptor beta1 deficiency.
12743658 2003 Missense mutations of the interleukin-12 receptor beta 1(IL12RB1) and interferon-gamma receptor 1 (IFNGR1) genes are not associated with susceptibility to lepromatous leprosy in Korea.
12719941 2003 Association study between interleukin-12 receptor beta1/beta2 genes and type 1 diabetes or asthma in the Japanese population.
12671732 2003 Genetic variations in the interleukin-12/interleukin-23 receptor (beta1) chain, and implications for IL-12 and IL-23 receptor structure and function.
12596048 2003 Influence of interleukin-12 receptor beta1 polymorphisms on tuberculosis.
12594833 2003 Severe Mycobacterium bovis BCG infections in a large series of novel IL-12 receptor beta1 deficient patients and evidence for the existence of partial IL-12 receptor beta1 deficiency.
12496448 2003 Impaired accumulation and function of memory CD4 T cells in human IL-12 receptor beta 1 deficiency.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12421946 2002 Regulation of virus-induced IL-12 and IL-23 expression in human macrophages.
12023369 2002 A receptor for the heterodimeric cytokine IL-23 is composed of IL-12Rbeta1 and a novel cytokine receptor subunit, IL-23R.
12020266 2002 Contribution of the interleukin 4 gene to susceptibility to subacute sclerosing panencephalitis.
11857344 2002 Requirement for both IL-12 and IFN-gamma signaling pathways in optimal IFN-gamma production by human T cells.
11424023 2001 Interleukin-12 receptor beta1 deficiency in a patient with abdominal tuberculosis.
11114383 2000 Novel p19 protein engages IL-12p40 to form a cytokine, IL-23, with biological activities similar as well as distinct from IL-12.
10415122 1999 Direct interaction of STAT4 with the IL-12 receptor.
9637763 1998 Interleukin-12 induces tyrosine phosphorylation of an 85-kDa protein associated with the interleukin-12 receptor beta 1 subunit.
9603733 1998 Severe mycobacterial and Salmonella infections in interleukin-12 receptor-deficient patients.
9469420 1998 IL-12 receptor (IL-12R) expression and accumulation of IL-12R beta 1 and IL-12R beta 2 mRNAs in CD4+ T cells by costimulation with B7-2 molecules.
9284929 1997 Assignment of IL12RB1 and IL12RB2, interleukin-12 receptor beta 1 and beta 2 chains, to human chromosome 19 band p13.1 and chromosome 1 band p31.2, respectively, by in situ hybridization.
8958915 1996 Molecular biology of interleukin-12 receptors.
8943050 1996 A functional interleukin 12 receptor complex is composed of two beta-type cytokine receptor subunits.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7911493 1994 Expression cloning of a human IL-12 receptor component. A new member of the cytokine receptor superfamily with strong homology to gp130.
7843232 1995 Mouse interleukin-12 (IL-12) p40 homodimer: a potent IL-12 antagonist.
7527811 1995 Human IL-12 p40 homodimer binds to the IL-12 receptor but does not mediate biologic activity.