Property Summary

Ligand Count 3
NCBI Gene PubMed Count 483
PubMed Score 19.27
PubTator Score 391.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Psoriatic arthritis 86 0.0 5.0
Disease Target Count Z-score Confidence
Asbestosis 20 3.127 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 4.900 1.8e-85

 GWAS Trait (1)

PDB (10)

Gene RIF (503)

AA Sequence

MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLG      1 - 70
SGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRF     71 - 140
TCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEV    141 - 210
MVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGK    211 - 280
SKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS                          281 - 328
//

Text Mined References (485)

PMID Year Title