Property Summary

NCBI Gene PubMed Count 445
PubMed Score 19.20
PubTator Score 391.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 4.900 1.8e-85

 GWAS Trait (1)

Protein-protein Interaction (4)

Gene RIF (463)

PMID Text
26874795 High serum IL-12 levels associated with increased densities of peritumoral CD8(+) T cells, intraepithelial CD3(+) T cells and intratumoral neutrophils, while high serum CCL4 levels associated with increased densities of peritumoral CD68(+) cells
26697414 These observations indicate a HDAC1-mediated IL-12B gene expression suppression by live, virulent Mycobacterium tuberculosis to subvert the immune system to survive and replicate in the host.
26667837 IL12Brs3212227 and IFNgammars2069705 variants were associated with a decreased risk of invasive aspergillosis.
26667304 a tendency of a higher prevalence of the genotype IL-12p40 pro1.1 in systemic arthritis and in rheumatoid factor negative polyarthritis was observed but not significant
26663019 genetic polymorphism is associated with allergic rhinitis in Chinese patients
26516307 variant IL-12p40 1188C/A genotype was AA (72.92%), AC (23.96%), and CC (3.13%%) in patients as compared to 65%, 30%, and 5%, respectively, in controls.
26472011 genetic polymorphism is associated with psoriasis in the South Indian Tamils
26430781 IL-12 immunomodulation delays the onset of lethal peritoneal disease of ovarian cancer.
26375522 the IL-12B rs3212227 AC and AC+CC genotypes are associated with rheumatoid arthritis risk in older patients,rheumatoid factor positive patients and anti-cyclic peptide antibodies negative patients
26302971 No association was observed for IL-12B and IFN-gamma polymorphisms between the rheumatoid arthritis patients and controls.
26239551 Human IL-21+IFN-gamma+CD4+ T cells in nasal polyps are regulated by IL-12.
26116899 HIV-1 Vpr downregulates the expression of IL12B in human monocyte-derived dendritic cells
26104769 Gene-gene interaction analysis showed that subjects carrying the IL-12A rs568408AG/AA and IL-12B rs3212227AA genotypes had a 2.40-fold increased risk of CRC (OR = 2.40; 95 % CI, 1.14-5.07)
26103568 8 SNPs (rs10045431, rs11167764, rs3212227, rs6556412, rs6556416, rs6871626, rs6887695 and rs7709212) were genotyped in Han ankylosing spondylitis patients and controls. rs6871626 may be associated AS susceptibility and activity.
26062743 Findings demonstrate that IL-12 is increased significantly in chronic hepatitis B patients and that viral protein HBx induces IL-12 expression in hepatocytes through the activation of the PI3K/Akt pathway.
26000455 The IL23R polymorphisms rs10889677, rs7517847, and the IL12B polymorphism rs3212227 are not associated with multiple sclerosis risk.
25985710 Peripheral blood mononuclear cells from severe asthmatic children release lower amounts of IL-12 and IL-4 after LPS stimulation.
25966091 Findings suggest that the interleukin 12B (IL-12B) and interleukin 10 (IL-10)-592 genotypes were distributed homogenously across all major ethnic groups, including Malays, Chinese, and Indians.
25943894 HIV-1 Vpr downregulates the expression of IL12B in human monocyte-derived dendritic cells
25931203 While Takayasu arteritis (TAK) patients with ulcerative colitis (UC) displayed a high frequency of the risk allele rs6871626 compared with TAK patients without UC, the difference was not significant.
25908236 Linkage disequilibrium of polymorphisms is reported in the IL-12 gene in patients with HCV infection and contributes to the understanding of patient genotype and expected production of IL-12, responding to infection.
25877925 mTORC2 regulates lipopolysaccharides-induced expression of IL-12 and IL-23 in human dendritic cells.
25848976 IL12B genetic polymorphism may contribute to melanoma susceptibility and prognosis.
25761185 Expression of IL12p40 was elevated both at mRNA and protein levels in IBD patients. Findings show that IL12p40 signaling had a key impact on the functions of human CD4+ T cells.
25710036 Based on these results, we believe that the increased levels of IL-12p40 and IL-16 are associated with an ongoing inflammatory response in obese individuals and could lead to the development of disease conditions related to obesity.
25614889 These results confirm the important role of TNF-a in the pathogenesis of nail psoriasis and may suggest that anti-TNF agents could be more beneficial in psoriatic nail disease than agents targeting IL-12/23 p40 or IL-17 .
25613737 Compared with the IL-12B-AA genotype, CC and combined CC/AC genotypes were associated with a significant decreased risk of Hepatitis C virus infection in Chinese hemodialysis patients.
25563480 IL-12 can induce monocytic tumor cells directional differentiation into macrophage-like cells.
25550844 DN was associated with enhanced Th1 response and suppression of Th2 responses which might be due to inreased levels of IL-12 and decreased levels of IL-33 cytokines respectively.
25548252 the secretion of IL-1alpha, IL-1beta, IL-12b, and CCL4 occurs during gelatinase degranulation, a process controlled by STX3.
25469793 No significant association was observed between rs2243115 in IL-12A and RA
25456886 our results reveal that circulating concentrations of IL-8 and IL-12 increase along with important vascular threatening traits as fasting serum glucose and VLDL-c, respectively
25447399 Data suggest that the IL-12p40 single nucleotide polymorphism rs3212227 is not associated with the risk of plaque psoriasis in Mestizo population in western Mexico.
25445750 The present meta-analysis suggests that the IL-12B+1188A/C polymorphism is a low-penetrant risk factor for HCC development, especially among Asians
25406098 Replicating the association of single-nucleotide polymorphisms in the TNFAIP3, IL12B and IL23R genes with psoriasis vulgaris, in subjects from different ethnic backgrounds, underlines their importance in the pathogenesis of the disease.
25292079 Interleukin-12B gene polymorphisms are associated with the risk of bladder cancer.
25234720 HIV-1 Vpr downregulates the expression of IL12B in human monocyte-derived dendritic cells
25202013 Medroxyprogesterone acetate differentially regulates interleukin (IL)-12 and IL-10 in a human ectocervical epithelial cell line in a glucocorticoid receptor (GR)-dependent manner
25201764 IL-12p40 response to in vitro stimulation in patients with Mendelian susceptibility to mycobacterial disease was below normal levels.
25200154 Data show that dsFvalpha gene and interleukin 12 (IL-12) gene were successfully expressed in the supernatant of transfected cells.
25177683 IL-12 and IL-10 seem to be affected by various modes of tobacco exposure and inflammation also affects median survival of cancer patients.
25131111 There was no statistical significance between IL12B, IL16, and IL18 (rs187238) gene polymorphisms and kidney graft outcome after transplantation.
25037175 We investigated the relations of three potentially functional single nucleotide polymorphisms (SNPs) in IL-12A (rs2243115 and rs568408) and IL-12B (rs3212227) with late-onset Alzheimer's disease.
25024369 These data indicate that type II Toxoplasma gondii GRA15II induction of CD40 promotes parasite immunity through the production of IL-12.
25015728 Data indicate that IL-23 p19, IL-23 p40 (IL-12 p40) and IL-23 receptor (IL-23R) were cytoplasmic/membranous over-expressed in colorectal cancer and normal tissues, but were reduced in lymph node metastases.
25008917 HIV-1 Vpr downregulates the expression of IL12B in human monocyte-derived dendritic cells
24957500 genetic variation at IL12B, IL23R and IL23A has an influence not only on the risk for psoriasis but also on disease severity and type 2 diabetes mellitus
24909386 preoperative serum concentration of IL-12p40 cytokine is a good prognostic marker for survival of patients with colorectal cancer
24876666 natural killer cells interact with mesenchymal stem cells for enhanced IL-12/IL-18-induced interferon-gamma secretion
24859272 Genetic variations of IL-12B, IL-12Rbeta1, IL-12Rbeta2 in Behcet's disease and VKH syndrome.
24808365 L. major, but not L. donovani, induces expression of IRF2, IRF7, and IFIT5, implicating the regulation of type I IFN-associated signaling pathways as mediating factors toward the production of IL-12.
24796719 balance of IL-23 vs IL-12/IL-27 signals into CD4(+) effector T cells determines whether tissue inflammation is perpetuated or resolves
24782489 ingestion of apoptotic cells by DCs leads to increased expression of IL-12p35 and Ebi3 without affecting IL-12p40.
24748538 These results show that IL-15 and IL-12 combination has the ability to expand the selective depletion of invariant natural killer T cells in vitro in HIV-infected individuals.
24654313 presence of SNPs in IL12B, TNFA, and IL1B was significantly associated with asthma, atopy, and severity of asthma.
24568095 A review of both experimental and human data that supports the hypothesis of a key pathogenic role of IL-23/Th17 axis in psoriasis.
24547735 IL12B gene SNPs were found to not be associated with multiple sclerosis susceptibility in a Chinese southern population.
24529168 The risk of gastric cardiac adenocarcinoma associated with the IL12B rs3212227 T > G polymorphism was evident among Chinese female patients and Chinese patients who never smoked or consumed alcoholic drinks.
24522266 Presence of Mycobacterium avium subspecies paratuberculosis, rs2241880 (ATG16L1) and rs10045431 (IL12B) were found to be significantly associated with Crohn's disease.
24418364 HIV-1 Vpr downregulates the expression of IL12B in human monocyte-derived dendritic cells
24365584 A meta-analysis suggests that the C allele of the IL12B 3' UTR may act as a tuberculosis risk factor in Caucasians but not in Asians or in Africans.
24161121 genetic polymorphism is associated with progression of hepatitis B to hepartocellular carcinoma in India
24158609 The IL-12A rs568408 and IL-12B rs3212227 polymorphisms were analyzed in relation to anti-hepatitis B antigens development in 602 hemodialysis patients.
24140476 Data indicate that carriers of variations in the IL6, IL12B and absence of HLA-Cw6 as having decreased risk for psoriasis.
24139871 IL12BCGT haplotype carriers presented lower parasitemia levels
24127073 Founder effect mutation in IL12B gene is responsible for Mendelian susceptibility to mycobacterial disease.
24073214 HIV-1 Vpr downregulates the expression of IL12B in human monocyte-derived dendritic cells
24051922 A meta-analysis indicates that the IL-12B +1188 A/C polymorphism could play a protective role in the development of cancer.
23991654 serum IL-12p40 levels associate with the risk of osteosarcoma and are regulated by IL-12B rs3212227 polymorphism.
23955419 Single nucleotide polymorphism in the IL12B is associated with psoriasis.
23901045 Advanced cancer patients had similar numbers of circulating myDC to cancer-free patients and healthy individuals, and secreted similar levels of IL-1beta, IL-6, IL-10, IL-12 and IL-23. However, myDC from some patients failed to secrete the Th1-cytokine IL-12
23844553 genetic polymorphisms are associated with psoriasis risk in Europeans
23830516 IL12B and HLA-B*52:01 regions are two synergistic susceptibility loci of Takayasu arteritis in a Japanese population.
23817431 Collectively, our data indicate that lipids secreted by adipocytes are able to modulate the phenotype of macrophages by inhibiting IL-12p40 secretion.
23755218 Poor nutritional status and frailty in subjects over 75 years were associated with decreased IL-12p70 and IL-23 production.
23734222 Data indicate that IL-12 increased after surgery in 38 of 52 cases.
23722323 An increased IL12p40 level characterizes the cerebrospinal fluid of mulitple sclerosis patients
23717436 TGF-beta1 blockade and IL-12p70 production augments antitumor immunity in tumor and dendritic cell fusions.
23679818 Data show that IFN-gamma induced the production of IL-12/23p40 and IL-23p19 mRNA as well as IL-12p40 and IL-23 proteins positively regulated by the p38 mitogen-activated protein kinases (MAPKs) in monocytes isolated through anti-CD14 microbeads.
23665963 IL12B variation is associated with need and time to early surgery in Crohn's disease.
23621408 IL-31 induces pro-inflammatory effects in activated human macrophages via STAT-1 and 5 phosphorylation. Interleukin-31-induced ERK 1/2 activation contributes to the underlying mechanism of Th1 cytokine IL-12 suppression in macrophages.
23600862 Data indicate that the Interleukin-12B single-nucleotide polymorphism (SNP) confers a susceptibility to HCV infection in a sex-dependent way in Egyptians.
23578145 IL-12B rs3212227 A variant was associated with higher levels of serum IL-12p40 and could possibly contribute to an inherited predisposition to brucellosis.
23575353 SNP in IL12B promoter is associated with asthma and decreased IL12B transcription.
23573954 SNP rs2288831 in the IL12B gene as a susceptible variation for Crohn's disease.
23527200 Increasing IL-4 and IL-12p40 production by bronchoalveolar lavage cells are biomarkers for Acid-fast bacillus in sputum of patients who present with radiographically advanced tuberculosis.
23441821 The IL-8 -251T/A and IL-12B 1188A/C polymorphisms may be relevant host susceptibility factors for the development of gout.
23429356 IL-12p40 deficiency has high but incomplete penetrance, with 33.3% of genetically affected relatives of index cases showing no symptoms of mendelian susceptibility to mycobacterial disease. However, prognosis is poor, with mortality rates of up to 28.6%.
23403235 IL-18 gene polymorphism contributes to bladder cancer risk whereas IL-12 is protective in a North Indian population.
23376980 The psoriasis IL12B risk haplotype leads to increased IL12B mRNA expression in interferon-gamma conditioned monocytes.
23297419 The p40 subunit of interleukin (IL)-12 promotes stabilization and export of the p35 subunit: implications for improved IL-12 cytokine production.
23297015 review/Meta-analysis: demonstrate a significant association between IL12B gene polymorphisms and psoriasis and psoriatic arthritis.
23285955 Silencing the SOCS1 and IL12 genes enhances dendritic cell-mediated anti-laryngocarcinoma immunity.
23240095 IL12B SNPs and copy number variation in IL23R gene associated with susceptibility to leprosy.
23154183 The dual commitment of IRF3 and IRF5 in the regulation of the Il12b enhancer and promoter is unique and may have implications for understanding the evolution of this gene.
23137633 susceptibility to T1DM in Croatians is not strongly associated with IL-18-137/-607 and IL-12B polymorphisms. These SNPs are associated with the higher risk of earlier disease development and might be implicated in the effectiveness of glycemic control.
23103228 Our study reveals the important role of IL12/IL18-mediated transcriptional regulation of IFN-gamma production in leprosy.
23099807 Results with IL-6 and IL-12p40 are in accordance with the hypothesis that the IL-17/IL-23 pathway has a suppressive role in cervical cancer.
23093722 There is a strong association between rs6887595 (IL12B) and psoriatic arthritis.
23071313 The production of lipopolysaccharides-induced TNF-alpha, IL-6, and IL-12p40 is increased significantly when miR-187 expression is silenced.
23065210 These findings suggest that the IL-12A and IL-12B independently and jointly be involved in the susceptibility to intracranial aneurysm.
23065198 IL-12B rs3212227 polymorphism probably is associated with a high risk of cancer. [Meta-analysis]
23053983 This study investigates gene expression of interleukin (IL)-12-related (IL-12A, IL-12B, IL-23A) cytokine and IL-10 in stimulated monocytes from colorectal cancer (CRC) patients.
23028907 A parent-of-origin effect in inflammatory bowel diseases was observed for single nucleotide polymorphisms in IL12B, PRDM1, and IL10.
22940148 Data show that SNP of IL-12B gene was associated with significantly increased overall risk of cancers, however, the SNPs of IL-12A gene did not appear to have an influence on cancer susceptibility.
22930279 The mRNA levels of p40, IL-20 and IL-21 at baseline may serve as potential predictors of treatment response to ustekinumab in psoriasis.
22897389 Results show significant interactions between BMI and two SNPs in the IL12B gene and also the association between a polymorphism in IL12B and psoriasis risk may be modified by measure of overall and central adiposity.
22863216 Development of anti-HBs in HD patients is associated with gene polymorphisms of interleukins involved in the Th1 system.
22819329 Autoimmune diseases appear to cluster in two groups that either show strong associations with the Th1/Th17 pathway (IL12B and IL23R) or the Th1/IL-35 pathway ( polymorphisms in the IL12A gene region). Review
22740240 Data indicate that IL-12B gene rs3212227 CC/AC and IL-12Rbeta1 gene 378 GG/GC genotypes, which associated with decreased IL-12p40 level, may contribute to esophageal cancer susceptibility.
22739501 Study indicated IL12B SNP rs6887695 (GG genotype) as a risk factor for psoriasis.
22702905 these results might imply that higher levels of IL-12 p40predispose to breast cancer
22656398 Interleukin-27 and interleukin-12 augment activation of distinct cord blood natural killer cells responses via STAT3 pathways.
22655069 HIV-1 Vpr downregulates the expression of IL12B in human monocyte-derived dendritic cells
22621617 It was concluded that IL12B gene polymorphisms were not associated with sex bias in Graves' disease and do not confer susceptibility to Graves' disease in the Chinese population.
22614250 Genotyped IL12A and IL12B polymorphisms in four hundred-five patients with cervical cancer and four hundred fifty unrelated Showed that the IL12B polymorphism may be a genetic risk factor for cervical cancer.
22581790 variation in the IL12B gene, but not IL12A, partly explains inter-individual differences in disease susceptibility and severity
22503230 Microbial keratitis were less likely to occur in wearers with the nonmutated IL-6 haplotype; wearers carrying an IL-12B SNP had an increased risk of sterile keratitis compared with controls.
22479607 The IL12B SNP rs6887695 modulates the susceptibility and the phenotype of inflammatory bowel disease, although the effect on inflammatory bowel disease susceptibilty is less pronounced than that of IL23R gene variants.
22384203 MCP1 SNPs and pulmonary tuberculosis in cohorts from West Africa, the USA and Argentina show a lack of association or epistasis with IL12B polymorphisms
22383962 recombinant human interleukin-12 is a potent mitigator of acute radiation injury in mice and non-human primates
22327783 evaluated presence of polymorphisms at 874 (T/A) IFNG and 1188 (A/C) IL-12B genes in cervical smears from healthy women and women, HPV positive, with CIN lesions and cervical cancer; for IL-12B gene, there was significant difference in genotype and allele distribution between groups; AA genotype and A allele were less frequent in the group with low-grade cervical lesions
22296201 IL-12B and its +1188 polymorphism may play a prominent role in the pathogenesis of Type 2 diabete
22194214 Pooled analysis corroborated the effect on multiple sclerosis predisposition of three genes: TMEM39A, IL12B, and CBLB
22144535 Polymorphisms in IL10 and IL12B that result in low production of proinflammatory cytokines are associated with persistent fungemia in candidemia patients.
22070668 TNF-alpha and IL12B 3'UTR gene polymorphisms may be associated with hepatitis b virus susceptibility and IL-10 gene polymorphisms may be related to the HBV persistence infection in Chinese Han HD patients.
22045842 Data show that the IL-12B A1188C genotype is associated with the development and disease severity of ankylosing spondylitis.
22011063 Gene-gene interactions of IL-12A rs2243115 and IL-12B rs3212227 may contribute to brain tumor susceptibility.
22005588 IL12 pathway highlights the interplay between innate and acquired immunity.
21972680 IL-12 subunit p40 and IL-10 serum levels were associated with progression of colorectal cancer.
21878338 Results show that cryopreservation of monocytes or iDCs leads to an impaired cytokine response for IL-10, TNF-alpha, IL-12p70 and IL-1beta.
21819616 The rs3212227 is a marker of susceptibility to SMA in children with acute disease, but does not appear to mediate functional changes in IL-12 production or longitudinal outcomes during the acquisition of naturally-acquired malarial immunity.
21796650 Glucan increases IL-12 production through NADPH oxidase-unrelated mechanisms.
21753150 IFN-beta mediates suppression of IL-12p40 in human dendritic cells following infection with virulent Francisella tularensis.
21747388 The individual contributions of these cytokines to specific pathologies require investigation and clinical evaluation of the role of IL-12- and IL-23-specific inhibitors.
21733366 Serum IL-18, IL-12 and TNF-alpha may be involved in the process of hepatic injury of intrahepatic cholestasis of pregnancy.
21689404 HIV-1 Vpr downregulates the expression of IL12B in human monocyte-derived dendritic cells
21641076 IL-12 and IL-23 were found to be abundantly expressed by macrophages infiltrating papillary and reticular dermis of hidradenitis suppurativa lesional skin
21637332 Tim-3 is constitutively expressed on human resting CD14(+) monocyte/macrophages (M/M(O)) and functions as a cap to block IL-12.
21623733 IL-12p40 +1188 A/C polymorphism is associated with nasopharyngeal cancer risk and tumor extension
21567173 mTOR pathway controls IL-12/IL-10 modulation by L. donovani in monocyte-dervied macrophages.
21513752 These results suggest that the SNPs in IL-12A rs568404 and IL-12B rs3212227 may individually and jointly contribute to the risk of asthma in a Chinese population.
21470215 There was no significant association between the allele and genotype frequency of the 3' UTR 1188 A/C polymorphism in the IL- 12p40 gene in 66 lepromatous leprosy patients.
21443923 The IL-8 -251A/T, IL-12B -1188A/C and TNF-alpha -238A/G polymorphisms may not be associated with susceptibility to TS in the Chinese Han population studied.
21397857 Data show that MMP-2-conditioned dendritic cells primed naive CD4(+) T cells to differentiate into an inflammatory T(H)2 phenotype through OX40L expression and inhibition of IL-12p70 production.
21351215 promoter site polymorphisms associated with ulcerative colitis
21339808 Genetic variation in IL12B, a highly relevant candidate gene, is a risk factor for pulmonary tuberculosis in populations of African ancestry.
21321105 C57BL/6 mice transgenic for colitis-prone SJL/J mouse p40 variant synthesize significantly more IL-12p70 upon lipopolysaccharide challenge and are more prone to develop colonic inflammation than are C57BL/6 mice transgenic for the C57BL/6-p40 variant.
21310195 The molecular mechanism of transcriptional regulation of the IL-12B gene by 1alpha,25(OH)(2)D(3) in lipopolysaccharide (LPS)-treated human monocytes (THP-1), was examined.
21278068 DNA copy number variation of IL12B gene is associated with systemic lupus erythematosus.
21208785 We identified significant combined effects between MHC and LCE, MHC and IL12B on the risk of psoriasis in Chinese population.
21198744 In men with autoimmune thyroid disease, a common variant located upstream of the IL12B coding region may influence whether patients present with Graves' disease or Hashimoto's disease.
21196650 Results showed that the alleles of +1188 region of IL-12 and alleles of +874 of IFN-gamma were also not associated with serum level of cytokines in HBV patients.
21145044 semiquinone glucoside derivative dose dependent study showed approximately similar level of induction in IL-12p40, IL-12p35, IL-23p19 and RelA proteins expression at all tested concentration (30-90 microg/ml) compared to control
21072187 Observational study of gene-disease association. (HuGE Navigator)
21055733 Established breast tumor cell lines expressed IL-12p40 transcripts and protein and IL-12p35 transcripts.
20953186 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20875477 Our study confirms the association of IL-12B with psoriasis and reveals that the G allele of rs6887695 of IL-12B and the A-A haplotype of rs11465817-rs1343152 of IL-23R confer an increased risk of psoriasis in the Chinese Han population.
20875078 Single-stranded RNA induced Interleukin-12 production in myeloid dendritic cells.
20811626 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20802378 Observational study of genetic testing. (HuGE Navigator)
20716621 Observational study of gene-disease association. (HuGE Navigator)
20714168 Findings in this study suggest that adiponectin, IL-12p70, and IL-13 may play a role in the pathogenesis of multiple sclerosis.
20711808 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20705102 inhibits acute myeloid leukemia cell growth
20673868 Observational study of gene-disease association. (HuGE Navigator)
20658240 Genotype-22 of IL12Bpro was predominantly combined with genotype-AA of a single nucleotide polymorphism in 3'UTR among systemic lupus erythematosus (SLE) patients and this combination elevates the risk of SLE.
20658240 Observational study of gene-disease association. (HuGE Navigator)
20653995 The allelic as well as genotypic frequencies of interleukin-12B gene polymorphisms did not significantly differ between HIV-1/AIDS patients and negative healthy controls.
20653995 Observational study of gene-disease association. (HuGE Navigator)
20653817 The observed discordance in periodontal breakdown in the studied monozygotic twin population may be related to the relatively low levels of IL-12p40 secretion after ex vivo stimulation of whole-blood cell cultures.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20621951 Early treatment of multiple sclerosis with IFN-beta1b may stabilize clinical disease by attenuating level of Il-12p40.
20568250 Observational study of gene-disease association. (HuGE Navigator)
20551083 Describe the successful construction, characterization and production of the heterodimeric immunocytokine F8-IL12. Engineered tumor-targeting heterodimeric immunocytokine F8-IL12 using different combinations of the two subunits (p35 and p40).
20544370 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20530519 Observational study of gene-disease association. (HuGE Navigator)
20525402 Observational study of gene-disease association. (HuGE Navigator)
20521253 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20503287 Observational study of gene-disease association. (HuGE Navigator)
20485444 Observational study of gene-disease association. (HuGE Navigator)
20483637 results indicate JNK1 negatively and JNK2 positively regulates IL-12 synthesis induced by LPS in THP-1 macrophages; PI3K p110beta affects JNK1 activity, but not JNK2 activity, as induced by LPS, resulting in positive regulation of IL-12 p40 production
20453000 Observational study of gene-disease association. (HuGE Navigator)
20452482 Observational study of gene-disease association. (HuGE Navigator)
20416077 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20399512 Clinical trial of gene-disease association. (HuGE Navigator)
20395963 Observational study of gene-disease association. (HuGE Navigator)
20387064 genotypic and haplotypic variation at IL12Bpro and IL12B 3' UTR in this population influences susceptibility to severe malaria and functional changes in circulating IL-12p40 and IFN-gamma levels.
20387064 Observational study of gene-disease association. (HuGE Navigator)
20372811 Data show that exosomes inhibited the expression of JAK3 and phosphorylation of STAT5 in high doses in T-cells, but not JAK2, while EXO/IL-12 had much less attenuated reduction of the expression of p-STAT5.
20371868 Observational study of genetic testing. (HuGE Navigator)
20350312 Observational study of gene-disease association. (HuGE Navigator)
20349123 TL1A increased cytotoxicity of IL-12/IL-18-activated NK cells against target cells dependent on NK activation for lysis and could function in vivo as a key co-activator of NK cytotoxicity.
20331378 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20236616 IL-2, IL-10 and IL-12B are regulated by 1alpha,25(OH)2D3
20217072 Observational study of gene-disease association. (HuGE Navigator)
20145925 Observational study of gene-disease association. (HuGE Navigator)
20105444 increased production by PBMC isolated from systemic lupus erythematosus patients
20061784 IL- 18 and IL-12p40 polymorphisms may have some effect on the onset age and deterioration of glycemic control in Turkish patients with type 1 diabetes mellitus.
20060272 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20054003 Data show that that 4-trifluoromethyl-celecoxib can inhibit secretion but not transcription of IL-12 (p35/p40) and IL-23 (p40/p19 heterodimers), and that this is associated with HERP function in the endoplasmic reticulum.
20027321 Susceptibility to tuberculous infection is associated with AC genotype of the polymorphic region A-1188C in the IL12 gene.
20016509 Studies indicate that modulation of TH-17 cell function and/or differentiation has proceeded to the greatest extent with monoclonal antibodies to IL-12 p40.
20014019 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20012528 HIV-1 Vpr downregulates the expression of IL12B in human monocyte-derived dendritic cells
20003322 The existence of a significant association between the [IL12B promoter allele] CTCTAA allele and susceptibility to cerebral malaria was confirmed in Southeast Asian population, which was previously reported in African populations.
20003322 Observational study of gene-disease association. (HuGE Navigator)
19956104 present the analysis of a set of single-nucleotide polymorphisms (SNPs) within and flanking the IL12B gene; no SNP showed individually significant association in the population as a whole.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19861958 Observational study of gene-disease association. (HuGE Navigator)
19860911 Observational study of gene-disease association. (HuGE Navigator)
19838195 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19832040 Polymorphisms in IL12B were not associated with the development of colorectal carcinoma but IL-12p40 serum levels were associated with disease progression.
19832040 Observational study of gene-disease association. (HuGE Navigator)
19819209 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19782084 Higher serum levels of IL-10 and IL-12 in HBeAg-positive patients are correlated with early, spontaneous HBeAg seroconversion
19773451 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
19760754 Observational study of gene-disease association. (HuGE Navigator)
19733878 Observational study of gene-disease association. (HuGE Navigator)
19705136 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19683555 Observational study of gene-disease association. (HuGE Navigator)
19646340 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19573080 Observational study of gene-disease association. (HuGE Navigator)
19554267 Observational study of gene-disease association. (HuGE Navigator)
19525409 data suggest that although IL23R contributes to Rheumatoid Arthritis aetiology, its effect is seemingly not the same as that reported in Crohn's disease.
19516896 analysis of the link between the evolutionary conservation of Vpr and its ability to suppress IL-12 secretion by DC
19505916 Observational study of gene-disease association. (HuGE Navigator)
19495883 Observational study of gene-disease association. (HuGE Navigator)
19487916 This is the first study to provide an evidence for the association of IL-12beta (1188A/C) gene polymorphism with the risk of cervical cancer.
19487916 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19435421 Polymorphismin the interleukin-12-3' untranslated region is associated with glioma.
19422935 Observational study of gene-disease association. (HuGE Navigator)
19419334 Reduced IL-12p40 and IL-10 production of monocyte-derived dendritic cells generated from HIV infected patients who were receiving receiving highly active antiretroviral therapy or are therapy naive is reported.
19342681 p40(2) participates in the pathogenesis of experimental allergic encephalomyelitis and that neutralization of p40(2) may be beneficial in multiple sclerosis patients
19328947 IL12B 3'UTR polymorphism does not affect graft survival, delayed graft function or acute rejection, but it has impact on the occurrence of cytomegalovirus infection after kidney transplantation.
19328947 Observational study of gene-disease association. (HuGE Navigator)
19279357 IL12B polymorphisms were found to be both positively (susceptible) and negatively (protective) associated with chronic obstructive pulmonary disease in Macedonians.
19274925 In asthmatic patients, the effects of the IL-12B polymorphism on asthma, allergic rhinitis, familial asthma, eosinophilia and total IgE levels, are controversial.
19274925 Observational study of gene-disease association. (HuGE Navigator)
19264456 Bioactive forms of IL-12 and IL-23 are highly expressed in various DC and macrophage subsets and their marked in situ production suggest that both cytokines have crucial pathogenic role in psoriasis.
19262574 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19258635 Observational study of gene-disease association. (HuGE Navigator)
19249008 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19247692 Observational study of gene-disease association. (HuGE Navigator)
19234184 HIV-1 Vpr downregulates the expression of IL12B in human monocyte-derived dendritic cells
19210338 genetic variants at position +16974 are associated with susceptibility to chronic periodontitis [in Taiwan]
19210338 Observational study of gene-disease association. (HuGE Navigator)
19185507 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19174780 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19169255 Strong replication for two known susceptibility loci MHC and IL12B in psoriasis.
19169255 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19169254 Expanded catalog of genetic loci implicated in psoriasis susceptibility.
19169254 Genome-wide association study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19134014 The IL-12/23p40 gene -6415CTCTAA/GC polymorphism is involved in cytokine production potential by affecting Sp1-mediated transcription activity.
19118071 These findings suggest that IL12A rs568408 and IL12B rs3212227 may individually and jointly contribute to the risk of cervical cancer and may modify cervical cancer risk associated with parity.
19118071 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19035472 Variation within IL23R and IL12B is associated with susceptibility to both psoriasis and psoriatic arthritis
19013323 HIV-1 Vpr downregulates the expression of IL12B in human monocyte-derived dendritic cells
19012493 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18834321 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18827961 Serum levels of p40 IL-12/23 may not be considered as a biologic tool of disease activity assessment in spondyloarthropathy (SpA) patients. Mean levels of synovial p40 IL12/23 were higher in SpA patients compared to osteoarthritis patients.
18821674 in the presence of IL-18, cutaneous lupus erythematosus keratinocytes failed to express IL-12
18800148 variants are not specific risk factors for arthritis, but relevant for susceptibility to psoriasis in general
18800148 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18717726 IL-12 promotes disease development in acute inflammatory demyelinating polyradiculoneuropathy.
18703108 results demonstrated that the production of IL-10 from PBMC depended on both -1082A*G in IL10 and +16974A*C in IL12B polymorphisms
18680750 Data suggest that the structure of interleukin-23 reveals the molecular basis of p40 subunit sharing with interleukin-12.
18676680 Observational study of gene-disease association. (HuGE Navigator)
18633131 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18632587 Polymorphisms in the IL12B promoter region associate with two different clinical courses of steroid-sensitive childhood nephrotic syndrome.
18631256 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18628242 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18619507 results demonstrate that IL-12 improves the cytotoxicity of NK cells in an NKG2D-dependent manner and augments the expression of cytotoxic effector molecules
18606709 study demonstrates that oxidative stress induced by soluble cigarette smoke components potently inhibits the production of IL-12 and IL-23 by maturing dendritic cells
18588591 Genotypical variations of the IL-12B (40) gene have not been investigated for schizophrenic patients yet.We examined polymorphic variants of IL-12B (p40).
18588591 Observational study of gene-disease association. (HuGE Navigator)
18563338 interleukin-12 has a role in the killing activity of lymphocytes on Hela cells
18557702 These results implicate IL-12 and IL-27 in regulating human macrophages, and IL-27 derived from macrophages during infection impedes control of Mycobacterium tuberculosis growth.
18522869 Observational study of gene-disease association. (HuGE Navigator)
18512797 interleukin 12B (IL12B) variants are not associated with rheumatoid arthritis.
18497679 Observational study of gene-disease association. (HuGE Navigator)
18485489 IL-12 p40 3'UTR 1188 A/C polymorphism is associated with greater susceptibility to lepromatous leprosy in patients from western Mexico
18485489 Observational study of gene-disease association. (HuGE Navigator)
18449199 This study characterized the genetic variation in IL12B in 215 individuals belonging to 34 families and evaluated linkage and association of parasitemia with IL12B polymorphisms and haplotypes.
18449199 Observational study of gene-disease association. (HuGE Navigator)
18438406 Observational study of gene-disease association. (HuGE Navigator)
18422730 Observational study of gene-disease association. (HuGE Navigator)
18413324 The IL12B promoter polymorphism was associated with susceptibility to cerebral malaria.
18413324 Observational study of gene-disease association. (HuGE Navigator)
18389618 Observational study of gene-disease association. (HuGE Navigator)
18383521 Single nucleotide polymorphism in IL12B is associated with inflammatory bowel disease.
18383521 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18369459 Genome-wide association study of gene-disease association. (HuGE Navigator)
18367309 IL12B polymorphisms IVS2 -912GG genotype and IVS2 -912G:IVS4 +314A haplotype are associated with increased risk for cervical cancer in Korean women.
18367309 Observational study of gene-disease association. (HuGE Navigator)
18341612 Observational study of gene-disease association. (HuGE Navigator)
18319400 NK cells require in vivo priming with IL-12/23 to acquire their full spectrum of functional reactivity, while T cells are dependent upon IL-12/23 signals for the differentiation and/or the maintenance of CD56(+) effector memory T cells
18300039 IL-12 p40 mRNA levels were significantly up-regulated in PHA-activated PBMCs.
18240960 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18219280 Polymorphisms of the IL12B and IL23R genes are associated with psoriasis.
18219280 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18192685 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18190588 an increased expression of IL-12 p40, IL-12 p35 and IL-23 p19 mRNA was observed in bone marrow mononuclear cells and peripheral blood mononuclear cells of patients with aplastic anemia compared with the corresponding one in normal controls.
18163209 Association of interleukin-6, interleukin-12, and interleukin-10 gene polymorphisms with essential hypertension in Tatars from Russia
18163209 Observational study of gene-disease association. (HuGE Navigator)
18092318 Observational study of gene-disease association. (HuGE Navigator)
18086266 Homozygosity of high producer IL-12p40 genotype IL-12Bpro-11 and -GG had the highest genetic risk of silicosis development in Bulgarian miners.
18086266 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18082575 Observational study of gene-disease association. (HuGE Navigator)
18082575 no strong evidence was present in this study to support a role for the IL12B/IL23R psoriasis-associated SNPs in multiple sclerosis susceptibility; the potential role of other, unlinked SNPs in these genes with a very modest influence cannot be excluded
18075513 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18048021 A heightened, perhaps persistent, activational state of IL-12(p40)/Stat4 signaling may be present in active Chinese ulcerative colitis (UC) patients, and possibly involved in chronic inflammation in UC.
18034172 polymorphism associated with early onset psoriasis
17994425 Observational study of gene-disease association. (HuGE Navigator)
17993580 Observational study of gene-disease association. (HuGE Navigator)
17945537 results here show that IL-23 is elevated in children with malarial anemia, and that IL-10 and IL-12 appear to have important regulatory effects on IL-23 production during childhood malaria
17932439 Observational study of gene-disease association. (HuGE Navigator)
17932439 IL -10 (-1082 G/A) and IL -12B 3'UTR (Taq I) (A/C) gene polymorphisms were not associated either with susceptibility or resistance to pulmonary tuberculosis in the south Indian population.
17901940 four variants (rs11209026, rs7517847, rs1343151, rs10889677) of IL-23R and the A1188C polymorphism (rs3212227) of IL-12B are unlikely to be major contributors to the pathogenesis of myocardial infarction
17901940 Observational study of gene-disease association. (HuGE Navigator)
17889143 Observational study of gene-disease association. (HuGE Navigator)
17881511 Engagement of gC1qR on dendritic cells by hepatitis C virus core protein limits the induction of Th1 responses by inhibiting TLR-induced IL-12 production and may contribute to viral persistence.
17846855 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17703412 Observational study of gene-disease association. (HuGE Navigator)
17653830 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17644387 Observational study of gene-disease association. (HuGE Navigator)
17644387 IL12B 3' UTR C allele was present at significantly higher frequency in cardiomyopathic as compared to asymptomatic. Results suggest that IL12B 3' UTR gene polymorphisms may influence the susceptibility to develop Chagasic cardiomyopathy.
17587057 Sequence variants in the genes for the interleukin-23 receptor (IL23R) and its ligand (IL12B) confer protection against psoriasis.
17587057 Observational study of gene-disease association. (HuGE Navigator)
17579859 IL-12 may have a role in progression of the colorectal adenoma-carcinoma sequence
17567674 downregulation of TLR2 and decreased production of interleukin-12 p40 and tumour necrosis factor-alpha following Mycobacterium avium or lipoteichoic acid stimulation may contribute to host susceptibility to nontuberculous mycobacterial lung disease
17564777 mRNA levels of IL12 subunit p40 in active SLE patients was significantly higher compared with those in the inactive SLE patients
17513774 IL-12p40-transgenic C57BL/6 mice characterized by overexpression of p40 show increased levels of serum IL-12p80 and enhanced disease susceptibility.
17509455 Observational study of gene-disease association. (HuGE Navigator)
17504509 Observational study of gene-disease association. (HuGE Navigator)
17504509 IL-12B-3'UTR polymorphism may contribute to silicosis severity rather than to susceptibility
17477815 Observational study of gene-disease association. (HuGE Navigator)
17445208 Observational study of gene-disease association. (HuGE Navigator)
17445208 Polymorphic variants in the IL12B gene is associated with leprosy and tuberculosis
17431094 HIV-1 Vpr downregulates the expression of IL12B in human monocyte-derived dendritic cells
17403771 upon activation with anti-CD3 and anti-CD28 antibodies, only 25% of the CD4+ T cells from HIV-1 patients showed an increase in the IL-12beta2 when compared with 50% in healthy controls
17392024 Observational study of gene-disease association. (HuGE Navigator)
17388919 Observational study of gene-disease association. (HuGE Navigator)
17327408 Observational study of gene-disease association. (HuGE Navigator)
17236132 Observational study of gene-disease association. (HuGE Navigator)
17236132 IL12B and IL23R genes play a fundamental role in psoriasis pathogenesis.
17172248 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17152005 Observational study of gene-disease association. (HuGE Navigator)
17148969 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17077296 HIV-1 Vpr downregulates the expression of IL12B in human monocyte-derived dendritic cells
16966828 Observational study of gene-disease association. (HuGE Navigator)
16948912 Th1-type cell and related cytokines might play an important role in the pathogenesis of HT and GD.
16789008 Observational study of gene-disease association. (HuGE Navigator)
16789008 The association of IL-12p40 A1188C polymorphism with the outcome of HCV infection is reported.
16772281 Increased concentrations of p40 subunit of IL-12/IL-23 in follicles containing oocytes suggest an important role of this cytokine in reproduction.
16750991 Observational study of gene-disease association. (HuGE Navigator)
16712658 The 1188A/C exchange in the IL12B gene is associated with Th1-mediated infectious diseases such as tuberculosis and salmonellosis
16681592 Observational study of gene-disease association. (HuGE Navigator)
16637265 Observational study of gene-disease association. (HuGE Navigator)
16600026 Observational study of gene-disease association. (HuGE Navigator)
16574246 Among cytokines affecting T helper type 1 (Th1)-Th2 balance, the levels of IL-12 p40 and its autoantibody are specifically elevated in patients with myasthenia gravis complicated by thymoma.
16514412 Observational study of gene-disease association. (HuGE Navigator)
16514412 Our results provide evidence for anti-bacterial host response toward Th1-immunity mediated by IL-12B in patients with Adamantiades-Behcet's disease (ABD), and the possible insight into the genetic susceptibility that is independent of HLA background.
16216674 Observational study of gene-disease association. (HuGE Navigator)
16210052 Observational study of gene-disease association. (HuGE Navigator)
16100774 Observational study of genotype prevalence. (HuGE Navigator)
16039994 The pro-inflammatory nature of hResistin was further evident from the ability of this protein to induce the nuclear translocation of NF-kappaB transcription factor as seen from electrophoretic mobility shift assays.
16005098 Observational study of gene-disease association. (HuGE Navigator)
16005098 The IL-12B 3'UTR A-C polymorphism would be considered as a supplementary risk factor for Type 1 diabetes in conjunction with HLA haplotypes.
15993716 Observational study of gene-disease association. (HuGE Navigator)
15988104 Observational study of gene-disease association. (HuGE Navigator)
15941730 Observational study of gene-disease association. (HuGE Navigator)
15937086 IL12B gene polymorphisms may affect the final steps of gastric carcinogenesis in H pylori infected subjects.
15871664 Observational study of gene-disease association. (HuGE Navigator)
15871664 chronically infected patients were significantly more likely than those with resolved HCV infection to be homozygous for the IL-12B 3'-UTR A allele
15869883 reversible histone acetylation/deacetylation modification plays an important role in the transcriptional regulation of IL-12
15858599 Observational study of genotype prevalence. (HuGE Navigator)
15837792 synthesis in RAW264.7 cells is induced by IRF-8
15644581 Observational study of gene-disease association. (HuGE Navigator)
15620465 Observational study of gene-disease association. (HuGE Navigator)
15620465 The IL12B 1188 (A-->C) gene polymorphism is not involved in defining the genetic basis of the susceptibility to and final outcome of peptic ulcer disease.
15603869 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
15603869 Heterozygosity of a polymorphism in the 3'untranslated region of the IL12B gene was associated with a delayed disease in late-onset diabetics.
15523691 study shows that PBMCs of patients with advanced gastric cancer show poor production of TNF and IL-12p40 in response to stimulation with tumor cells in vitro & this unresponsiveness is associated in some patients with diminished IRAK-1 expression in vivo
15483662 Observational study of gene-disease association. (HuGE Navigator)
15483662 A direct role for IL12B in susceptibility to inflammatory bowel disease is unlikely.
15482860 p300 is involved in the transcriptional regulation of IL-12 p40, and IL-12 p40 is one of the target genes of p300
15464247 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15464247 No association of IL12B polymorphisms and self-limited HCV infection could be demonstrated.
15448160 interleukin 12 and interferon gamma are involved in inhibition of cytotrophoblastic cell invasion
15356557 Decreased LPS-induced IL-12(p70) and IL-10 responses were associated with the TLR4 (Asp299Gly) polymorphism and independently with asthma, especially atopic asthma in school-age children
15331709 HIV-1 Vpr downregulates the expression of IL12B in human monocyte-derived dendritic cells
15322986 Observational study of gene-disease association. (HuGE Navigator)
15322986 We found a strong association between the IL12B_4237 and IL12B_6402 polymorphisms and an asthma-severity phenotype in whites.
15295696 Observational study of gene-disease association. (HuGE Navigator)
15295696 association between IL12B intron 2 polymorphism and tuberculosis and between specific IL12B haplotypes and TB found in Hong Kong Chinese population
15285014 Observational study of gene-disease association. (HuGE Navigator)
15285014 The polymorphism of IL12B (1188A/C) appears to have some influence on the outcome of hepatitis c virus infection.
15102082 Observational study of gene-disease association. (HuGE Navigator)
15102082 Frequencies of the various genotypes for the promoter region of the gene encoding IL-12p40 (IL12B) did not differ between psoriasis patients and controls.
15057902 Observational study of gene-disease association. (HuGE Navigator)
15007350 Observational study of gene-disease association. (HuGE Navigator)
15007350 no evidence to support the presence of a heterozygote effect of the IL12B promoter polymorphism on the level of asthma in early childhood or adulthood
15004750 Observational study of gene-disease association. (HuGE Navigator)
14976188 identify erythroid Kruppel-like factor as a transcription factor in macrophages able to regulate IL-12 p40 transcription depending on the cellular activation status
14962816 Observational study of gene-disease association. (HuGE Navigator)
14764743 HIV-1 Vpr downregulates the expression of IL12B in human monocyte-derived dendritic cells
14746806 Data show that reverse signaling via 4-1BB-ligand enhanced interleukin-12beta mRNA and the secretion of IL-12 p70 in various antigen-presenting cells, including monocytes.
14679201 interleukin-12 p40 transcription and NF-kappaB activation are inhibited by nitric oxide in macrophages and dendritic cells
14675396 Observational study of gene-disease association. (HuGE Navigator)
14675396 The IL12B TaqI gene polymorphisms do not appear to be involved in susceptibility to celiac disease
14597672 HIV-1 Vpr downregulates the expression of IL12B in human monocyte-derived dendritic cells
14551880 Observational study of gene-disease association. (HuGE Navigator)
14551880 IL-12B 3'untranslated region has no effect or has a negligible effect on human susceptibility to tuberculosis.
12914676 These two potentially important candidate gene single nucleotide polymorphisms are not associated with susceptibility to idiopathic pulmonary fibrosis.
12876411 Diesel exhaust particles seem to inhibit the production of IL-12 p40 in lipopolysaccharide activated monocytes as a model for lung macrophages
12857749 Interleukin-10 induction of endothelial nitric-oxide synthase expression attenuates CD40-mediated interleukin-12 synthesis in human endothelial cells.
12719551 HIV-1 Vpr downregulates the expression of IL12B in human monocyte-derived dendritic cells
12672403 A key mechanism in the pathogenesis of MS is the increased expression of CD86 and CD40L and the increased production of IL12 during disease progression.
12542496 HIV-1 Vpr downregulates the expression of IL12B in human monocyte-derived dendritic cells
12472178 IL-12 expression in PMN of SLE patients was less prominent than that of the normal controls.
12424627 Observational study of gene-disease association. (HuGE Navigator)
12424624 Observational study of gene-disease association. (HuGE Navigator)
12413772 Observational study of gene-disease association. (HuGE Navigator)
12413772 IL12B SNP is associated with susceptibility to atopic dermatitis and psoriasis vulgaris, presumably by affecting the Th1/Th2 balance.
12370346 HIV-1 Vpr downregulates the expression of IL12B in human monocyte-derived dendritic cells
12297341 role of CD28 and IL-12/IL-15 signaling impairment in T cell proliferative deficiency during senescence
12270766 possible role of IL-12 and tissue antioxidants in development and progression of chronic sinusitis
12241719 Observational study of gene-disease association. (HuGE Navigator)
12241719 IL12B promoter heterozygosity contributes to asthma severity rather than susceptibility per se.
12207325 ATPgammaS potentiated the IL-12p40 release induced by TNF-alpha. This potentiation was observed as long as the IL-12p40 concentration under agonist stimulation remained below a threshold value close to 10 ng/ml; inhibition was observed above this value.
12202149 results suggest that impaired IL-12 production in HIV-infected myeloid cells occurs, in part, via disruption of IL-12 p40 gene expression in a manner that requires cellular infection
12117918 The purified lipoprotein, Lpk, from Mycobacterium leprae, was found to induce production of interleukin-12 in human peripheral blood monocytes
12117904 Leishmania priming of human dendritic cells for CD40 ligand-induced interleukin-12p40 secretion is strain and species dependent
12100467 DISCUSSION FORUM: it is the p40 protein, either alone or paired with other polypeptides, rather than p75, that acts as an interface between the innate and adaptive immune responses
12065887 results suggest that LPS stimulates the pituitary gland directly in vivo to increase IL-12 p40 gene expression
11978670 Observational study of gene-disease association. (HuGE Navigator)
11972887 Observational study of gene-disease association. (HuGE Navigator)
11972887 The IL12B gene does not confer susceptibility to coeliac disease
11940489 STATE OF ART REVIEW. Malignant B-cells from follicular and marginal zone lymphomas expressed IL-12 p35 and p40 transcripts, whereas only p35 mRNA was detected in mantle cell lymphoma.
11820460 Heparins (unfractionated heparin, UFH and low molecular weight heparin certoparin) had no effect on the release of IL-1ra, IL-10, and IL-12p40 from neutrophils or peripheral blood mononuclear cells.
11813133 Observational study of gene-disease association. (HuGE Navigator)
11753820 inherited interleukin-12 deficiency: IL12B genotype and clinical phenotype of 13 patients from six kindreds
11751963 HIV-1 Vpr downregulates the expression of IL12B in human monocyte-derived dendritic cells
11196715 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
11087201 HIV-1 Vpr downregulates the expression of IL12B in human monocyte-derived dendritic cells
10352291 HIV-1 Vpr downregulates the expression of IL12B in human monocyte-derived dendritic cells
9712080 HIV-1 Vpr downregulates the expression of IL12B in human monocyte-derived dendritic cells
9671213 HIV-1 Vpr downregulates the expression of IL12B in human monocyte-derived dendritic cells
9516412 HIV-1 Vpr downregulates the expression of IL12B in human monocyte-derived dendritic cells
9225992 HIV-1 Vpr downregulates the expression of IL12B in human monocyte-derived dendritic cells
9158092 HIV-1 Vpr downregulates the expression of IL12B in human monocyte-derived dendritic cells
9108403 HIV-1 Vpr downregulates the expression of IL12B in human monocyte-derived dendritic cells
8648753 HIV-1 Vpr downregulates the expression of IL12B in human monocyte-derived dendritic cells
8627017 HIV-1 Vpr downregulates the expression of IL12B in human monocyte-derived dendritic cells
7867080 HIV-1 Vpr downregulates the expression of IL12B in human monocyte-derived dendritic cells
7695626 HIV-1 Vpr downregulates the expression of IL12B in human monocyte-derived dendritic cells

AA Sequence

MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLG      1 - 70
SGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRF     71 - 140
TCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEV    141 - 210
MVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGK    211 - 280
SKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS                          281 - 328
//

Text Mined References (447)

PMID Year Title
26874795 2016 The relationships between serum cytokine levels and tumor infiltrating immune cells and their clinical significance in colorectal cancer.
26697414 2015 Mycobacterium tuberculosis Infection Induces HDAC1-Mediated Suppression of IL-12B Gene Expression in Macrophages.
26667837 2015 Polymorphisms in Host Immunity-Modulating Genes and Risk of Invasive Aspergillosis: Results from the AspBIOmics Consortium.
26667304 2015 No association of IL-12p40 pro1.1 polymorphism with juvenile idiopathic arthritis.
26663019 2016 Genetic variations in interleukin-12B in allergic rhinitis.
26516307 2015 Single Nucleotide Polymorphisms in IL-10, IL-12p40, and IL-13 Genes and Susceptibility to Glioma.
26472011 2016 Investigation of association of the IL-12B and IL-23R genetic variations with psoriatic risk in a South Indian Tamil cohort.
26430781 2016 Interleukin-12 Immunomodulation Delays the Onset of Lethal Peritoneal Disease of Ovarian Cancer.
26375522 2015 Association between polymorphisms of interleukin 12 and rheumatoid arthritis associated biomarkers in a Chinese population.
26302971 2015 Interleukin-18, interleukin-12B and interferon-? gene polymorphisms in Brazilian patients with rheumatoid arthritis: a pilot study.
26239551 2015 Human IL-21+IFN-?+CD4+ T cells in nasal polyps are regulated by IL-12.
26104769 2015 Interaction analysis of IL-12A and IL-12B polymorphisms with the risk of colorectal cancer.
26103568 2015 Association Study of IL-12B Polymorphisms Susceptibility with Ankylosing Spondylitis in Mainland Han Population.
26062743 2015 Up-regulation of IL-12 expression in patients with chronic hepatitis B is mediated by the PI3K/Akt pathway.
26000455 2016 Meta-analysis of the IL23R and IL12B polymorphisms in multiple sclerosis.
25985710 Peripheral blood mononuclear cells from severe asthmatic children release lower amounts of IL-12 and IL-4 after LPS stimulation.
25966091 2015 IL-10 and IL-12B gene polymorphisms in a multiethnic Malaysian population.
25931203 2015 Takayasu arteritis and ulcerative colitis: high rate of co-occurrence and genetic overlap.
25908236 2015 Haplotype analysis finds linkage disequilibrium in the IL-12 gene in patients with HCV.
25877925 2015 Mammalian target of rapamycin complex 2 (mTORC2) regulates LPS-induced expression of IL-12 and IL-23 in human dendritic cells.
25848976 2015 Association of Common Genetic Polymorphisms with Melanoma Patient IL-12p40 Blood Levels, Risk, and Outcomes.
25761185 2015 IL12p40 regulates functional development of human CD4+ T cells: enlightenment by the elevated expressions of IL12p40 in patients with inflammatory bowel diseases.
25710036 2015 Elevated plasma levels of interleukin-12p40 and interleukin-16 in overweight adolescents.
25642632 2015 Discovery of six new susceptibility loci and analysis of pleiotropic effects in leprosy.
25614889 2014 Serum levels of TNF- ? , IL-12/23 p40, and IL-17 in psoriatic patients with and without nail psoriasis: a cross-sectional study.
25613737 2015 Relationships between interleukin-12B and interleukin-10 gene polymorphisms and hepatitis C in Chinese Han hemodialysis patients.
25563480 2015 IL-12 could induce monocytic tumor cells directional differentiation.
25550844 2014 Increased IL-12 and decreased IL-33 serum levels are associated with increased Th1 and suppressed Th2 cytokine profile in patients with diabetic nephropathy (CURES-134).
25548252 2015 An essential role of syntaxin 3 protein for granule exocytosis and secretion of IL-1?, IL-1?, IL-12b, and CCL4 from differentiated HL-60 cells.
25469793 2015 Association of polymorphisms in interleukin (IL)-12A and -B genes with rheumatoid arthritis in a Chinese population.
25456886 Pro-inflammatory cytokines correlate with classical risk factors for atherosclerosis in the admixed Brazilian older women.
25447399 2015 The 3'UTR 1188A/C polymorphism of IL-12p40 is not associated with susceptibility for developing plaque psoriasis in Mestizo population from western Mexico.
25445750 2014 Interleukin-12B+1188A/C polymorphism contributes to increased hepatocellular carcinoma susceptibility: evidence from a meta-analysis.
25406098 2015 TNFAIP3 and IL12B gene polymorphisms associated with psoriasis vulgaris in an Egyptian cohort.
25292079 2014 Interleukin-12 and interleukin-6 gene polymorphisms and risk of bladder cancer in the Iranian population.
25202013 2014 Medroxyprogesterone acetate differentially regulates interleukin (IL)-12 and IL-10 in a human ectocervical epithelial cell line in a glucocorticoid receptor (GR)-dependent manner.
25201764 Impaired in-vitro responses to IL-12 and IFN-? in Iranian patients with Mendelian susceptibility to mycobacterial disease.
25200154 2014 [Construction and application of plasmid pVAX-HBVE harboring hepatitis B surface antibody targeted interferon and interleukin 12 genes].
25177683 2014 Tobacco exposure by various modes may alter proinflammatory (IL-12) and anti-inflammatory (IL-10) levels and affects the survival of prostate carcinoma patients: an explorative study in North Indian population.
25131111 The impact of interleukin 12B (1188A>C), interleukin 16 (-295T>C), and interleukin 18 (607C>A, 137G>C) gene polymorphisms on long-term renal transplant function and recipient outcomes.
25037175 2014 Association of IL-12A and IL-12B polymorphisms with Alzheimer's disease susceptibility in a Han Chinese population.
25024369 2014 Type II Toxoplasma gondii induction of CD40 on infected macrophages enhances interleukin-12 responses.
25015728 2014 Investigation of IL-23 (p19, p40) and IL-23R identifies nuclear expression of IL-23 p19 as a favorable prognostic factor in colorectal cancer: a retrospective multicenter study of 675 patients.
24957500 2014 Genetic variation at IL12B, IL23R and IL23A is associated with psoriasis severity, psoriatic arthritis and type 2 diabetes mellitus.
24909386 2014 The prognostic value of preoperative serum levels of IL-12p40 and IL-23 for survival of patients with colorectal cancer.
24876666 2014 Interaction with mesenchymal stem cells provokes natural killer cells for enhanced IL-12/IL-18-induced interferon-gamma secretion.
24859272 2014 Genetic variations of IL-12B, IL-12R?1, IL-12R?2 in Behcet's disease and VKH syndrome.
24808365 2014 Human dendritic cells exhibit a pronounced type I IFN signature following Leishmania major infection that is required for IL-12 induction.
24796719 2014 IL-27 and IL-12 oppose pro-inflammatory IL-23 in CD4+ T cells by inducing Blimp1.
24782489 2014 Phagocytosis of apoptotic or necrotic cells differentially regulates the transcriptional expression of IL-12 family members in dendritic cells.
24748538 2015 Interleukins 15 and 12 in combination expand the selective loss of natural killer T cells in HIV infection in vitro.
24654313 2013 Polymorphisms of the IL12B, IL1B, and TNFA genes and susceptibility to asthma.
24568095 2014 Role of IL-23 in the pathogenesis of psoriasis: a novel potential therapeutic target?
24547735 2014 Association of IL-23 and its receptor gene single-nucleotide polymorphisms with multiple sclerosis in Chinese southern population.
24529168 2015 Interleukin 12B rs3212227 T?>?G polymorphism was associated with an increased risk of gastric cardiac adenocarcinoma in a Chinese population.
24522266 2014 Detection of Mycobacterium avium subspecies paratuberculosis in patients with Crohn's disease is unrelated to the presence of single nucleotide polymorphisms rs2241880 (ATG16L1) and rs10045431 (IL12B).
24365584 2014 Association between IL12B polymorphisms and tuberculosis risk: a meta-analysis.
24161121 2014 Effect of IL-12B, IL-2, TGF-?1, and IL-4 polymorphism and expression on hepatitis B progression.
24158609 2013 Association of the interleukin-12 polymorphic variants with the development of antibodies to surface antigen of hepatitis B virus in hemodialysis patients in response to vaccination or infection.
24140476 Genetic variations in IL6 and IL12B decreasing the risk for psoriasis.
24139871 2014 Role of IL6, IL12B and VDR gene polymorphisms in Plasmodium vivax malaria severity, parasitemia and gametocytemia levels in an Amazonian Brazilian population.
24127073 2014 A 1,100-year-old founder effect mutation in IL12B gene is responsible for Mendelian susceptibility to mycobacterial disease in Tunisian patients.
24051922 2013 Meta-analysis of the association between the IL-12B +1188 A/C polymorphism and cancer risk.
23991654 2013 Association of interleukin-12 polymorphisms and serum IL-12p40 levels with osteosarcoma risk.
23955419 2013 IL12B and IL23R gene SNPs in Japanese psoriasis.
23901045 2014 Novel function for the p38-MK2 signaling pathway in circulating CD1c+ (BDCA-1+) myeloid dendritic cells from healthy donors and advanced cancer patients; inhibition of p38 enhances IL-12 whilst suppressing IL-10.
23844553 2013 Associations between interleukin-23R and interleukin-12B polymorphisms and psoriasis susceptibility: a meta-analysis.
23830516 2013 Two susceptibility loci to Takayasu arteritis reveal a synergistic role of the IL12B and HLA-B regions in a Japanese population.
23817431 2013 Adipocytes modulate the phenotype of human macrophages through secreted lipids.
23755218 2013 Frailty in old age is associated with decreased interleukin-12/23 production in response to toll-like receptor ligation.
23734222 2013 Increase of IL-12 following reconstruction for total en bloc spondylectomy using frozen autografts treated with liquid nitrogen.
23722323 2014 Interleukin-12p40 in the spinal fluid as a biomarker for clinically isolated syndrome.
23717436 2013 Augmentation of antitumor immunity by fusions of ethanol-treated tumor cells and dendritic cells stimulated via dual TLRs through TGF-?1 blockade and IL-12p70 production.
23679818 2013 Engagement of CD14 sensitizes primary monocytes to IFN-? to produce IL-12/23p40 and IL-23 through p38 mitogen-activated protein kinase and independent of the janus kinase/signal transducers and activators of transcription signaling.
23665963 2013 Multidimensional prognostic risk assessment identifies association between IL12B variation and surgery in Crohn's disease.
23621408 2013 Interleukin (IL)-31 activates signal transducer and activator of transcription (STAT)-1, STAT-5 and extracellular signal-regulated kinase 1/2 and down-regulates IL-12p40 production in activated human macrophages.
23600862 2013 Interleukin-12B gene polymorphism frequencies in Egyptians and sex-related susceptibility to hepatitis C infection.
23578145 2013 Levels of interleukin-(IL)-12p40 are markedly increased in Brucellosis among patients with specific IL-12B genotypes.
23575353 2013 A functional variant in IL12B promoter modulates its expression and associates with increased risk of allergic asthma.
23573954 2013 Genetic variants in the IL12B gene are associated with inflammatory bowel diseases in the Korean population.
23527200 2013 Increased production of IL-4 and IL-12p40 from bronchoalveolar lavage cells are biomarkers of Mycobacterium tuberculosis in the sputum.
23441821 2013 IL-8 -251T/A and IL-12B 1188A/C polymorphisms are associated with gout in a Chinese male population.
23429356 2013 Inherited IL-12p40 deficiency: genetic, immunologic, and clinical features of 49 patients from 30 kindreds.
23403235 2013 Association of IL-12, IL-18 variants and serum IL-18 with bladder cancer susceptibility in North Indian population.
23376980 2013 Susceptibility-associated genetic variation at IL12B enhances Th1 polarization in psoriasis.
23297419 2013 The p40 subunit of interleukin (IL)-12 promotes stabilization and export of the p35 subunit: implications for improved IL-12 cytokine production.
23297015 2013 Meta-analysis of IL12B polymorphisms (rs3212227, rs6887695) with psoriasis and psoriatic arthritis.
23285955 2012 [Silencing of SOCS1 and IL-12 gene cotransferred by adenoviral enhances DC-mediated anti-laryngocarcinoma immunity in vitro].
23240095 2013 IL12B SNPs and copy number variation in IL23R gene associated with susceptibility to leprosy.
23154183 2013 Regulation of cooperative function of the Il12b enhancer and promoter by the interferon regulatory factors 3 and 5.
23137633 2013 Polymorphisms in the IL-18 and IL-12B genes and their association with the clinical outcome in Croatian patients with Type 1 diabetes.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23103228 2012 Identification of IL18RAP/IL18R1 and IL12B as leprosy risk genes demonstrates shared pathogenesis between inflammation and infectious diseases.
23099807 2012 Role of IL-12p40 in cervical carcinoma.
23093722 2013 Exploring ankylosing spondylitis-associated ERAP1, IL23R and IL12B gene polymorphisms in subphenotypes of psoriatic arthritis.
23071313 2012 IL-10-induced microRNA-187 negatively regulates TNF-?, IL-6, and IL-12p40 production in TLR4-stimulated monocytes.
23065210 2012 Interactions of interleukin-12A and interleukin-12B polymorphisms on the risk of intracranial aneurysm.
23065198 2012 Interleukin-12B rs3212227 polymorphism and cancer risk: a meta-analysis.
23053983 2012 Monocytes expression of IL-12 related and IL-10 genes in association with development of colorectal cancer.
23028907 2012 Limited evidence for parent-of-origin effects in inflammatory bowel disease associated loci.
23006423 2012 Genetic association with overall survival of taxane-treated lung cancer patients - a genome-wide association study in human lymphoblastoid cell lines followed by a clinical association study.
22940148 2012 Functional polymorphisms in the interleukin-12 gene contribute to cancer risk: evidence from a meta-analysis of 18 case-control studies.
22930279 2013 IL-20, IL-21 and p40: potential biomarkers of treatment response for ustekinumab.
22897389 2013 Interactions between adiposity and genetic polymorphisms on the risk of psoriasis.
22863216 2012 Antibodies to hepatitis B virus surface antigen and interleukin 12 and interleukin 18 gene polymorphisms in hemodialysis patients.
22819329 2012 Genetic variations in interleukin-12 related genes in immune-mediated diseases.
22740240 2012 Associations between polymorphisms in IL-12A, IL-12B, IL-12R?1, IL-27 gene and serum levels of IL-12p40, IL-27p28 with esophageal cancer.
22739501 2012 Resequencing of the IL12B gene in psoriasis patients with the rs6887695/rs3212227 risk genotypes.
22702905 2012 Single nucleotide polymorphism in the interleukin 12B gene is associated with risk for breast cancer development.
22656398 2012 Interleukin-27 and interleukin-12 augment activation of distinct cord blood natural killer cells responses via STAT3 pathways.
22621617 2012 No association between IL12B gene polymorphisms and Graves' disease in the Chinese population.
22614250 2012 Contribution of IL12A and IL12B polymorphisms to the risk of cervical cancer.
22581790 2012 Effect of IL12A and IL12B polymorphisms on the risk of Chlamydia trachomatis-induced tubal factor infertility and disease severity.
22503230 2012 Association of single nucleotide polymorphisms of interleukins-1?, -6, and -12B with contact lens keratitis susceptibility and severity.
22479607 2012 Analysis of IL12B gene variants in inflammatory bowel disease.
22384203 2012 MCP1 SNPs and pulmonary tuberculosis in cohorts from West Africa, the USA and Argentina: lack of association or epistasis with IL12B polymorphisms.
22383962 2012 HemaMax™, a recombinant human interleukin-12, is a potent mitigator of acute radiation injury in mice and non-human primates.
22327783 2012 IFN-gamma and IL-12B polymorphisms in women with cervical intraepithellial neoplasia caused by human papillomavirus.
22296201 2012 Genetic variation of IL-12B (+1188 region) is associated with its decreased circulating levels and susceptibility to Type 2 diabetes.
22194214 2012 Replication study of 10 genes showing evidence for association with multiple sclerosis: validation of TMEM39A, IL12B and CBLB [correction of CLBL] genes.
22190364 2011 Genome-wide meta-analysis identifies novel multiple sclerosis susceptibility loci.
22144535 2012 Cytokine gene polymorphisms and the outcome of invasive candidiasis: a prospective cohort study.
22070668 2012 Relationships between tumour necrosis factor-?, interleukin-12B and interleukin-10 gene polymorphisms and hepatitis B in Chinese Han haemodialysis patients.
22045842 2012 Association of IL-12B genetic polymorphism with the susceptibility and disease severity of ankylosing spondylitis.
22011063 2012 Gene-gene interactions between interleukin-12A and interleukin-12B with the risk of brain tumor.
22005588 2012 Towards common denominators in primary biliary cirrhosis: the role of IL-12.
21972680 2010 [Role of IL-12P40 and IL-10 in progression of colorectal cancer].
21878338 2011 Cryopreservation of monocytes or differentiated immature DCs leads to an altered cytokine response to TLR agonists and microbial stimulation.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
21819616 2011 Polymorphic variability in the 3' untranslated region (UTR) of IL12B is associated with susceptibility to severe anaemia in Kenyan children with acute Plasmodium falciparum malaria.
21796650 2012 Prostate carcinoma cells LNCaP and glucan cooperate in induction of cytokine synthesis by dendritic cells: effect on natural killer cells and CD4+ lymphocytes activation.
21753150 2011 IFN-? mediates suppression of IL-12p40 in human dendritic cells following infection with virulent Francisella tularensis.
21747388 2011 Therapeutic targeting of the IL-12/23 pathways: generation and characterization of ustekinumab.
21743469 2011 Interaction between ERAP1 and HLA-B27 in ankylosing spondylitis implicates peptide handling in the mechanism for HLA-B27 in disease susceptibility.
21733366 2011 [Expression and significance of interleukin-18, 12 and tumor necrosis factor-? in intrahepatic cholestasis of pregnancy].
21641076 2011 Expression of the IL-23/Th17 pathway in lesions of hidradenitis suppurativa.
21637332 2011 Tim-3 negatively regulates IL-12 expression by monocytes in HCV infection.
21623733 2011 Association of IL-12p40 +1188 A/C polymorphism with nasopharyngeal cancer risk and tumor extension.
21567173 2012 mTOR signaling pathway regulates the IL-12/IL-10 axis in Leishmania donovani infection.
21513752 2011 Association of single nucleotide polymorphisms in interleukin 12 (IL-12A and -B) with asthma in a Chinese population.
21470215 2012 Lack of association between 3' UTR 1188 A/C polymorphism in the IL-12p40 gene and lepromatous leprosy in Sinaloa, Mexico.
21443923 2011 Association of IL8 -251A/T, IL12B -1188A/C and TNF-? -238A/G polymorphisms with Tourette syndrome in a family-based association study in a Chinese Han population.
21397857 2011 Matrix metalloproteinase-2 conditions human dendritic cells to prime inflammatory T(H)2 cells via an IL-12- and OX40L-dependent pathway.
21351215 2011 Functional polymorphism in IL12B promoter site is associated with ulcerative colitis.
21339808 2011 Interleukin 12B (IL12B) genetic variation and pulmonary tuberculosis: a study of cohorts from The Gambia, Guinea-Bissau, United States and Argentina.
21321105 2011 A polymorphism in the coding region of Il12b promotes IL-12p70 and IL-23 heterodimer formation.
21310195 2011 Mechanism of 1?,25-dihydroxyvitamin D(3)-dependent repression of interleukin-12B.
21297633 2011 Meta-analysis identifies 29 additional ulcerative colitis risk loci, increasing the number of confirmed associations to 47.
21278068 2011 Copy number variations of Interleukin-12B and T-bet are associated with systemic lupus erythematosus.
21208785 2011 Variants in MHC, LCE and IL12B have epistatic effects on psoriasis risk in Chinese population.
21198744 2011 The clinical presentation of autoimmune thyroid disease in men is associated with IL12B genotype.
21196650 Non-association of IL-12 +1188 and IFN-? +874 polymorphisms with cytokines serum level in occult HBV infected patients.
21145044 2011 Induction of immunostimulatory cytokine genes expression in human PBMCs by a novel semiquinone glucoside derivative (SQGD) isolated from a Bacillus sp. INM-1.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
21072187 2010 Evidence for significant overlap between common risk variants for Crohn's disease and ankylosing spondylitis.
21055733 2011 Human breast tumor cells express IL-10 and IL-12p40 transcripts and proteins, but do not produce IL-12p70.
20953190 2010 A genome-wide association study identifies new psoriasis susceptibility loci and an interaction between HLA-C and ERAP1.
20953188 2010 Genome-wide association study identifies a psoriasis susceptibility locus at TRAF3IP2.
20953186 2010 Common variants at TRAF3IP2 are associated with susceptibility to psoriatic arthritis and psoriasis.
20875477 2010 Replication of association between interleukin-23 receptor (IL-23R) and its ligand (IL-12B) polymorphisms and psoriasis in the Chinese Han population.
20875078 2011 Interferon-? and interleukin-12 are induced, respectively, by double-stranded DNA and single-stranded RNA in human myeloid dendritic cells.
20811626 2010 Genetic variants in inflammation-related genes are associated with radiation-induced toxicity following treatment for non-small cell lung cancer.
20802378 2010 A multiplex MALDI-TOF MS approach facilitates genotyping of DNA from formalin-fixed paraffin-embedded tumour specimens.
20716621 2010 Genetic polymorphisms in adaptive immunity genes and childhood acute lymphoblastic leukemia.
20714168 2011 Serum adiponectin, TNF-?, IL-12p70, and IL-13 levels in multiple sclerosis and the effects of different therapy regimens.
20711808 2010 Polymorphisms in oxidative stress and inflammation pathway genes, low-dose ionizing radiation, and the risk of breast cancer among US radiologic technologists.
20705102 2010 Direct inhibition of human acute myeloid leukemia cell growth by IL-12.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20658240 2012 Functional genetic polymorphisms in interleukin-12B gene in association with systemic lupus erythematosus.
20653995 2010 Insights into the role of IL-12B and IFN-gamma cytokine gene polymorphisms in HIV-1/AIDS infection.
20653817 2010 Monozygotic twins are discordant for chronic periodontitis: white blood cell counts and cytokine production after ex vivo stimulation.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20621951 2010 Alterations in serum MMP-8, MMP-9, IL-12p40 and IL-23 in multiple sclerosis patients treated with interferon-beta1b.
20570966 2010 Fucosyltransferase 2 (FUT2) non-secretor status is associated with Crohn's disease.
20568250 2010 Common single nucleotide polymorphisms in immunoregulatory genes and multiple myeloma risk among women in Connecticut.
20551083 2010 Expression, engineering and characterization of the tumor-targeting heterodimeric immunocytokine F8-IL12.
20544370 2010 Association of genetic polymorphisms in the IL12-IFNG pathway with susceptibility to and prognosis of pulmonary tuberculosis in a Chinese population.
20530519 2010 Interleukin 4 and STAT6 gene polymorphisms are associated with systemic lupus erythematosus in Chinese patients.
20525402 2010 Analysis of eight genes modulating interferon gamma and human genetic susceptibility to tuberculosis: a case-control association study.
20521253 2011 IL12 polymorphisms, HBV infection and risk of hepatocellular carcinoma in a high-risk Chinese population.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20485444 2010 Common polymorphisms in ITGA2, PON1 and THBS2 are associated with coronary atherosclerosis in a candidate gene association study of the Chinese Han population.
20483637 2010 JNK1 and JNK2 differently regulate IL-12 production in THP-1 macrophage cells.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20428758 2010 IL-23 promotes growth and proliferation in human squamous cell carcinoma of the oral cavity.
20416077 2010 Identification of type 2 diabetes-associated combination of SNPs using support vector machine.
20399512 2010 Nontuberculous mycobacterial cervicofacial lymphadenitis in children from the multicenter, randomized, controlled trial in The Netherlands: relevance of polymorphisms in candidate host immunity genes.
20395963 2010 Replication of genetic association studies in asthma and related phenotypes.
20387064 2010 Haplotypes of IL12B promoter polymorphisms condition susceptibility to severe malaria and functional changes in cytokine levels in Thai adults.
20372811 2010 Interleukin-12-anchored exosomes increase cytotoxicity of T lymphocytes by reversing the JAK/STAT pathway impaired by tumor-derived exosomes.
20371868 2010 Application of high-resolution melting to large-scale, high-throughput SNP genotyping: a comparison with the TaqMan method.
20350312 2010 Polymorphisms in genes of interleukin 12 and its receptors and their association with protection against severe malarial anaemia in children in western Kenya.
20349123 2010 TL1A selectively enhances IL-12/IL-18-induced NK cell cytotoxicity against NK-resistant tumor targets.
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20236616 2010 The genes encoding cytokines IL-2, IL-10 and IL-12B are primary 1alpha,25(OH)2D3 target genes.
20217072 2010 SNP/haplotype associations in cytokine and cytokine receptor genes and immunity to rubella vaccine.
20145925 2010 C-reactive protein -717C>T genetic polymorphism associates with esophagectomy-induced stress hyperglycemia.
20105444 2010 Oxidative stress in systemic lupus erythematosus: relationship to Th1 cytokine and disease activity.
20061784 Association of polymorphisms in the IL-18 and IL-12 genes with susceptibility to Type 1 diabetes in Turkish patients.
20060272 2010 Association of single nucleotide polymorphisms in the IL-12 (IL-12A and B) and IL-12 receptor (IL-12Rbeta1 and beta2) genes and gene-gene interactions with atopic dermatitis in Koreans.
20054003 2010 Inhibition of secretion of interleukin (IL)-12/IL-23 family cytokines by 4-trifluoromethyl-celecoxib is coupled to degradation via the endoplasmic reticulum stress protein HERP.
20027321 2009 Allelic polymorphism of cytokine genes during pulmonary tuberculosis.
20027291 2009 Salmonella induced IL-23 and IL-1beta allow for IL-12 production by monocytes and Mphi1 through induction of IFN-gamma in CD56 NK/NK-like T cells.
20016509 2010 Mixed results with modulation of TH-17 cells in human autoimmune diseases.
20014019 2010 Genome wide association (GWA) predictors of anti-TNFalpha therapeutic responsiveness in pediatric inflammatory bowel disease.
20003322 2009 A replication study of the association between the IL12B promoter allele CTCTAA and susceptibility to cerebral malaria in Thai population.
19956104 2009 Evaluation of IL12B as a candidate type I diabetes susceptibility gene using data from the Type I Diabetes Genetics Consortium.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19861958 2010 Genetic analysis in a Dutch study sample identifies more ulcerative colitis susceptibility loci and shows their additive role in disease risk.
19860911 2009 Variation in cytokine genes can contribute to severity of acetabular osteolysis and risk for revision in patients with ABG 1 total hip arthroplasty: a genetic association study.
19838195 2009 A large-scale replication study identifies TNIP1, PRDM1, JAZF1, UHRF1BP1 and IL10 as risk loci for systemic lupus erythematosus.
19832040 2009 Association of polymorphisms in regulatory regions of interleukin-12p40 gene and cytokine serum level with colorectal cancer.
19819209 2009 Influence of cytokine gene variations on immunization to childhood vaccines.
19782084 2010 Serum levels of interleukin-10 and interleukin-12 predict early, spontaneous hepatitis B virus e antigen seroconversion.
19773451 2009 Role of inflammation gene polymorphisms on pain severity in lung cancer patients.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19760754 2010 Analysis of 39 Crohn's disease risk loci in Swedish inflammatory bowel disease patients.
19733878 2009 Interferon-gamma 874A>T genetic polymorphism is associated with infectious complications following surgery in patients with thoracic esophageal cancer.
19705136 2010 Genetic evidence for involvement of the IL23 pathway in Thai psoriatics.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19683555 2009 Role of human leukocyte antigen, killer-cell immunoglobulin-like receptors, and cytokine gene polymorphisms in leptospirosis.
19646340 Interleukin-12 gene polymorphisim in patients with giant cell arteritis, polymyalgia rheumatica and elderly-onset rheumatoid arthritis.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19573080 2009 Common genetic variants in candidate genes and risk of familial lymphoid malignancies.
19554267 2009 The influence of JNK and P38 MAPK inhibition on IL-12P40 and IL-23 production depending on IL12B promoter polymorphism.
19525409 2009 IL23R and IL12B genes: susceptibility analysis in rheumatoid arthritis.
19516896 2009 The immunosuppressive properties of the HIV Vpr protein are linked to a single highly conserved residue, R90.
19505916 2009 Cytokine and cytokine receptor single-nucleotide polymorphisms predict risk for non-small cell lung cancer among women.
19495883 2009 CRP genetic polymorphism is associated with lymph node metastasis in thoracic esophageal squamous cell cancer.
19487916 2009 Interleukin-12 gene polymorphism and cervical cancer risk.
19435421 2009 A novel functional polymorphism, 16974 A/C, in the interleukin-12-3' untranslated region is associated with risk of glioma.
19422935 2009 Genetic risk profiling and prediction of disease course in Crohn's disease patients.
19419334 2009 Monocyte-derived dendritic cells from HIV type 1-infected individuals show reduced ability to stimulate T cells and have altered production of interleukin (IL)-12 and IL-10.
19342681 2009 Functional blocking monoclonal antibodies against IL-12p40 homodimer inhibit adoptive transfer of experimental allergic encephalomyelitis.
19328947 2009 Impact of a polymorphism in the IL-12p40 gene on the outcome of kidney transplantation.
19279357 2009 Association of cytokine gene polymorphisms with chronic obstructive pulmonary disease in Macedonians.
19274925 2009 Relationship between the IL-12B promoter polymorphism and allergic rhinitis, familial asthma, serum total IgE, and eosinophil level in asthma patients.
19264456 2009 Increased expression of IL-12p70 and IL-23 by multiple dendritic cell and macrophage subsets in plaque psoriasis.
19262574 2009 Genome-wide association scan yields new insights into the immunopathogenesis of psoriasis.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19258635 2009 Association of cytokine and chemokine gene polymorphisms with severe acute respiratory syndrome.
19249008 2009 Diverse genome-wide association studies associate the IL12/IL23 pathway with Crohn Disease.
19247692 2009 Analyses of associations with asthma in four asthma population samples from Canada and Australia.
19210338 2009 Interleukin-10 (-592 C/A) and interleukin-12B (+16974 A/C) gene polymorphisms and the interleukin-10 ATA haplotype are associated with periodontitis in a Taiwanese population.
19185507 2009 Common polymorphisms in interleukin genes (IL4, IL6, IL8 and IL12) are not associated with alcoholic liver disease or alcoholism in Spanish men.
19174780 2009 Confirmation of multiple Crohn's disease susceptibility loci in a large Dutch-Belgian cohort.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19169255 2009 Psoriasis genome-wide association study identifies susceptibility variants within LCE gene cluster at 1q21.
19169254 2009 Genome-wide scan reveals association of psoriasis with IL-23 and NF-kappaB pathways.
19134014 2009 Functional analysis of a polymorphism in the promoter region of the IL-12/23p40 gene.
19118071 2009 Interactions of IL-12A and IL-12B polymorphisms on the risk of cervical cancer in Chinese women.
19088061 2009 IL-23 modulates CD56+/CD3- NK cell and CD56+/CD3+ NK-like T cell function differentially from IL-12.
19035472 2008 Investigation of association of the IL12B and IL23R genes with psoriatic arthritis.
19012493 2009 Common variants in immune and DNA repair genes and risk for human papillomavirus persistence and progression to cervical cancer.
18834321 2008 Can we predict neuropathy risk before stavudine prescription in a resource-limited setting?
18827961 2009 Serum and synovial fluid levels of p40 IL12/23 in spondyloarthropathy patients.
18821674 2008 Evidence for a pathogenetic role of interleukin-18 in cutaneous lupus erythematosus.
18800148 2009 Genetic variants of the IL-23R pathway: association with psoriatic arthritis and psoriasis vulgaris, but no specific risk factor for arthritis.
18717726 2008 The role of IL-12 and TNF-alpha in AIDP and AMAN.
18708069 2008 Crystal structures of the pro-inflammatory cytokine interleukin-23 and its complex with a high-affinity neutralizing antibody.
18703108 2008 The combined effect of interleukin (IL)-10 and IL-12 polymorphisms on induced cytokine production.
18680750 2008 The structure of interleukin-23 reveals the molecular basis of p40 subunit sharing with interleukin-12.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18675459 2008 IL-23 and IL-12 responses in activated human T cells retrovirally transduced with IL-23 receptor variants.
18633131 2008 Host immune gene polymorphisms in combination with clinical and demographic factors predict late survival in diffuse large B-cell lymphoma patients in the pre-rituximab era.
18632587 2008 The clinical course of steroid-sensitive childhood nephrotic syndrome is associated with a functional IL12B promoter polymorphism.
18631256 2008 The relationship between ApoE, TNFA, IL1a, IL1b and IL12b genes and HIV-1-associated dementia.
18628242 2008 Cytokine gene polymorphisms and the risk of adenocarcinoma of the stomach in the European prospective investigation into cancer and nutrition (EPIC-EURGAST).
18619507 2008 Interleukin-12 improves cytotoxicity of natural killer cells via upregulated expression of NKG2D.
18606709 2008 Cigarette smoke-induced oxidative stress suppresses generation of dendritic cell IL-12 and IL-23 through ERK-dependent pathways.
18588591 2008 The value of interleukin-12B (p40) gene promoter polymorphism in patients with schizophrenia in a region of East Turkey.
18587394 2008 Genome-wide association defines more than 30 distinct susceptibility loci for Crohn's disease.
18563338 2008 Immune killing activity of lymphocytes on Hela cells expressing interleukin-12 in vitro.
18557702 2008 Interleukin-12 and interleukin-27 regulate macrophage control of Mycobacterium tuberculosis.
18522869 2008 Cytokine gene polymorphisms and cytokine levels in pulmonary tuberculosis.
18512797 2008 The inflammatory disease-associated variants in IL12B and IL23R are not associated with rheumatoid arthritis.
18497679 2008 Association between a polymorphism in the IL-12p40 gene and cytomegalovirus reactivation after kidney transplantation.
18485489 2008 The 3'UTR 1188 A/C polymorphism in the interleukin-12p40 gene (IL-12B) is associated with lepromatous leprosy in the west of Mexico.
18449199 2008 IL12B polymorphisms are linked but not associated with Plasmodium falciparum parasitemia: a familial study in Burkina Faso.
18438406 2008 Genetic determinants of ulcerative colitis include the ECM1 locus and five loci implicated in Crohn's disease.
18422730 2008 Interleukin 12B gene polymorphism and apparent resistance to hepatitis C virus infection.
18413324 2008 A functional promoter variant in IL12B predisposes to cerebral malaria.
18389618 [Influence of polymorphism of immune defense modifier genes on celiac disease development and various clinical features of disease in Tomsk population].
18383521 2008 IL23R and IL12B polymorphisms in Spanish IBD patients: no evidence of interaction.
18369459 2008 A genome-wide association study of psoriasis and psoriatic arthritis identifies new disease loci.
18367309 2008 Interleukin-12 p40 gene (IL12B) polymorphisms and the risk of cervical cancer in Korean women.
18341612 2008 The value of serum neopterin, interferon-gamma levels and interleukin-12B polymorphisms in predicting acute renal allograft rejection.
18319400 2008 A role for interleukin-12/23 in the maturation of human natural killer and CD56+ T cells in vivo.
18300039 2008 Quantitative evaluation of interleukin-12 p40 gene expression in peripheral blood mononuclear cells.
18240960 2008 Cytokine genotype suggests a role for inflammation in nucleoside analog-associated sensory neuropathy (NRTI-SN) and predicts an individual's NRTI-SN risk.
18219280 2008 Polymorphisms of the IL12B and IL23R genes are associated with psoriasis.
18192685 2008 A pro-inflammatory genotype predisposes to Barrett's esophagus.
18190588 2009 Elevated expression of IL-12 and IL-23 in patients with aplastic anemia.
18163209 2008 Association of interleukin-6, interleukin-12, and interleukin-10 gene polymorphisms with essential hypertension in Tatars from Russia.
18092318 2008 Comprehensive evaluation of positional candidates in the IL-18 pathway reveals suggestive associations with schizophrenia and herpes virus seropositivity.
18086266 2008 IL-12Bpro and GSTP1 polymorphisms in association with silicosis.
18082575 2007 The autoimmune disease-associated IL12B and IL23R polymorphisms in multiple sclerosis.
18075513 2008 Variants in the 5q31 cytokine gene cluster are associated with psoriasis.
18048021 2007 Increased expression and activation of IL-12-induced Stat4 signaling in the mucosa of ulcerative colitis patients.
18034172 2008 Polymorphisms in the IL-12beta and IL-23R genes are associated with psoriasis of early onset in a UK cohort.
17994425 2007 Interleukin (IL)-12, IL-2, interferon-gamma gene polymorphisms in subacute sclerosing panencephalitis patients.
17993580 2008 Psoriasis is associated with pleiotropic susceptibility loci identified in type II diabetes and Crohn disease.
17945537 2008 Increased circulating interleukin (IL)-23 in children with malarial anemia: in vivo and in vitro relationship with co-regulatory cytokines IL-12 and IL-10.
17932439 2007 Interleukin-12B & interleukin-10 gene polymorphisms in pulmonary tuberculosis.
17901940 2008 Association analysis of IL-12B and IL-23R polymorphisms in myocardial infarction.
17889143 2007 Cytokine polymorphisms and risk of infection after kidney transplantation.
17888176 2007 IL-23 induces human osteoclastogenesis via IL-17 in vitro, and anti-IL-23 antibody attenuates collagen-induced arthritis in rats.
17881511 2007 HCV core protein interaction with gC1q receptor inhibits Th1 differentiation of CD4+ T cells via suppression of dendritic cell IL-12 production.
17846855 2007 Clarithromycin resistance, tumor necrosis factor alpha gene polymorphism and mucosal inflammation affect H. pylori eradication success.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17653830 2007 Sun exposure, vitamin D receptor gene polymorphisms and risk of non-Hodgkin lymphoma.
17644387 2007 Polymorphism in the 3' UTR of the IL12B gene is associated with Chagas' disease cardiomyopathy.
17587057 2007 Sequence variants in the genes for the interleukin-23 receptor (IL23R) and its ligand (IL12B) confer protection against psoriasis.
17579859 2007 Distinct changes of dendritic cell number and IL-12 mRNA level in adjacent mucosa throughout the colorectal adenoma-carcinoma sequence.
17567674 2007 Impaired expression of Toll-like receptor 2 in nontuberculous mycobacterial lung disease.
17564777 2007 Dysregulated expression of interleukin-23 and interleukin-12 subunits in systemic lupus erythematosus patients.
17554261 2007 Sequence variants in the autophagy gene IRGM and multiple other replicating loci contribute to Crohn's disease susceptibility.
17513774 2007 Dendritic cell-derived IL-12p40 homodimer contributes to susceptibility in cutaneous leishmaniasis in BALB/c mice.
17509455 2007 Polymorphisms of interferon-gamma, interleukin-10, and interleukin-12 genes in myasthenia gravis.
17504509 2007 Interleukin-12B-3'UTR polymorphism in association with IL-12p40 and IL-12p70 serum levels and silicosis severity.
17477815 2007 Polymorphisms in proinflammatory genes and susceptibility to typhoid fever and paratyphoid fever.
17445208 2007 Association of variants in the IL12B gene with leprosy and tuberculosis.
17403771 2007 Skewed expression and up-regulation of the IL-12 and IL-18 receptors in resting and activated CD4 T cells from HIV-1-infected patients.
17392024 2007 Association of polymorphisms in IL-12/IFN-gamma pathway genes with susceptibility to pulmonary tuberculosis in Indonesia.
17388919 2007 Cytokine gene polymorphisms in Chinese patients with psoriasis.
17327408 2007 Prognostic significance of host immune gene polymorphisms in follicular lymphoma survival.
17236132 2007 A large-scale genetic association study confirms IL12B and leads to the identification of IL23R as psoriasis-risk genes.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17172248 2006 [The 1188 A/C ILI2B gene polymorphism in patients with multiple sclerosis and in healthy subjects of Tomsk region].
17152005 2007 Associations between measles vaccine immunity and single-nucleotide polymorphisms in cytokine and cytokine receptor genes.
17148969 2007 Interaction between allelic variation in IL12B and CCR5 affects the development of AIDS: IL12B/CCR5 interaction and HIV/AIDS.
16966828 2006 Interleukin-12B gene polymorphism does not confer susceptibility to Graves' ophthalmopathy in Japanese population.
16948912 2006 [Measurement of IL-12 and IL-18 in sera of patients with autoimmune thyroid disease].
16942485 2006 Differential effects of insulin-like growth factor-1 and atheroma-associated cytokines on cell proliferation and apoptosis in plaque smooth muscle cells of symptomatic and asymptomatic patients with carotid stenosis.
16789008 2006 Studies on TAQ1 polymorphism in the 3'untranslated region of IL-12P40 gene in HCV patients infected predominantly with genotype 3.
16772281 2006 Ovarian follicular concentration of IL-12, IL-15, IL-18 and p40 subunit of IL-12 and IL-23.
16751425 2006 IL-23 is increased in dendritic cells in multiple sclerosis and down-regulation of IL-23 by antisense oligos increases dendritic cell IL-10 production.
16750991 2006 Association of IL13 with total IgE: evidence against an inverse association of atopy and diabetes.
16712658 2006 Association between the 1188 A/C polymorphism in the human IL12B gene and Th1-mediated infectious diseases.
16681592 2006 No association of cytokine gene polymorphisms in Chinese patients with atopic dermatitis.
16637265 [A comparative analysis of tuberculosis susceptibility genetic make-up in Tuvinians and Russians].
16600026 2006 Asthma families show transmission disequilibrium of gene variants in the vitamin D metabolism and signalling pathway.
16574246 2006 Elevation of IL-12 p40 and its antibody in myasthenia gravis with thymoma.
16514412 2006 Role of IL-12B promoter polymorphism in Adamantiades-Behcet's disease susceptibility: An involvement of Th1 immunoreactivity against Streptococcus Sanguinis antigen.
16482511 2006 Divergent effects of IL-12 and IL-23 on the production of IL-17 by human T cells.
16216674 2005 Th1 cytokine polymorphisms in spanish patients with type 1 diabetes.
16210052 2005 Functional haplotypes of IL-12B are associated with childhood atopic asthma.
16100774 2005 Cytokine gene polymorphisms in population of ethnic Macedonians.
16039994 2005 Human resistin stimulates the pro-inflammatory cytokines TNF-alpha and IL-12 in macrophages by NF-kappaB-dependent pathway.
16005098 2006 Interleukin-12p40 gene (IL-12B) polymorphism and Type 1 diabetes mellitus in Japanese: possible role in subjects without having high-risk HLA haplotypes.
15993716 2005 Interleukin 12 (IL12B) and interleukin 12 receptor (IL12RB1) gene polymorphisms in rheumatoid arthritis.
15988104 2005 Polymorphism of the 3'-untranslated region of interleukin-12 p40 gene is not associated with the presence or severity of coronary artery disease.
15941730 2005 Interleukin 12 (IL12B), interleukin 12 receptor (IL12RB1) and interleukin 23 (IL23A) gene polymorphism in systemic lupus erythematosus.
15937086 2005 Interleukin 12 gene polymorphisms enhance gastric cancer risk in H pylori infected individuals.
15871664 2005 Polymorphisms in the IL-12B gene and outcome of HCV infection.
15869883 2005 Interleukin-12 p40 promoter activity is regulated by the reversible acetylation mediated by HDAC1 and p300.
15858599 2005 Taq-I polymorphism in 3'UTR of the IL-12B and association with IL-12p40 production from human PBMC.
15837792 2005 Ubiquitin-dependent degradation of interferon regulatory factor-8 mediated by Cbl down-regulates interleukin-12 expression.
15644581 2004 Lack of association between IL-12B gene polymorphism and autoimmune thyroid disease in Japanese patients.
15620465 2005 Lack of association of IL-12 p40 gene polymorphism with peptic ulcer disease.
15603869 2004 Alleles of the IL12B 3'UTR associate with late onset of type 1 diabetes.
15523691 2005 Depressed tumor necrosis factor alpha and interleukin-12p40 production by peripheral blood mononuclear cells of gastric cancer patients: association with IL-1R-associated kinase-1 protein expression and disease stage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15483662 2004 Definition of polymorphisms and haplotypes in the interleukin-12B gene: association with IL-12 production but not with Crohn's disease.
15482860 2004 Histone acetyltransferase activity of p300 enhances the activation of IL-12 p40 promoter.
15464247 2004 Influence of interleukin 12B (IL12B) polymorphisms on spontaneous and treatment-induced recovery from hepatitis C virus infection.
15448160 2004 Inhibition of cytotrophoblastic (JEG-3) cell invasion by interleukin 12 involves an interferon gamma-mediated pathway.
15356557 2004 A TLR4 polymorphism is associated with asthma and reduced lipopolysaccharide-induced interleukin-12(p70) responses in Swedish children.
15322986 2004 The IL12B gene is associated with asthma.
15295696 2004 Associations between IL12B polymorphisms and tuberculosis in the Hong Kong Chinese population.
15285014 2004 Association of interleukin-12 p40 gene 3'-untranslated region polymorphism and outcome of HCV infection.
15265908 2004 ICOS expression by activated human Th cells is enhanced by IL-12 and IL-23: increased ICOS expression enhances the effector function of both Th1 and Th2 cells.
15114670 2004 Commensal Gram-negative bacteria prime human dendritic cells for enhanced IL-23 and IL-27 expression and enhanced Th1 development.
15102082 2004 Psoriasis is not associated with IL-12p70/IL-12p40 production and IL12B promoter polymorphism.
15057902 2004 HLA and cytokine gene polymorphisms are independently associated with responses to hepatitis B vaccination.
15007350 2004 Associations of the IL12B promoter polymorphism in longitudinal data from asthmatic patients 7 to 42 years of age.
15004750 2004 Association between IFNA genotype and the risk of sarcoidosis.
14976188 2004 Activation and repression of interleukin-12 p40 transcription by erythroid Kruppel-like factor in macrophages.
14962816 2004 Genetic approaches to assessing evidence for a T helper type 1 cytokine defect in adult asthma.
14746806 2003 4-1BB-ligand is regulated on human dendritic cells and induces the production of IL-12.
14679201 2004 Inhibition of interleukin-12 p40 transcription and NF-kappaB activation by nitric oxide in murine macrophages and dendritic cells.
14675396 2003 IL12B and IRF1 gene polymorphisms and susceptibility to celiac disease.
14551880 2003 No evidence for association between the polymorphism in the 3' untranslated region of interleukin-12B and human susceptibility to tuberculosis.
12914676 2003 Analysis of IL-12 p40 subunit gene and IFN-gamma G5644A polymorphisms in Idiopathic Pulmonary Fibrosis.
12876411 2003 Reduction of IL-12 p40 production in activated monocytes after exposure to diesel exhaust particles.
12857749 2003 Interleukin-10 induction of nitric-oxide synthase expression attenuates CD40-mediated interleukin-12 synthesis in human endothelial cells.
12672403 2003 Monocyte-derived IL12, CD86 (B7-2) and CD40L expression in relapsing and progressive multiple sclerosis.
12542496 2003 HIV-1 matrix protein p17 enhances the proliferative activity of natural killer cells and increases their ability to secrete proinflammatory cytokines.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12472178 Decreased IL-12 production by polymorphonuclear leukocytes in patients with active systemic lupus erythematosus.
12424627 2002 The IL12B 3' untranslated region DNA polymorphism is not associated with early-onset type 1 diabetes.
12424624 2002 A TaqI polymorphism in the 3'UTR of the IL-12 p40 gene correlates with increased IL-12 secretion.
12421946 2002 Regulation of virus-induced IL-12 and IL-23 expression in human macrophages.
12413772 2002 Interleukin-12 p40 gene (IL12B) 3'-untranslated region polymorphism is associated with susceptibility to atopic dermatitis and psoriasis vulgaris.
12297341 2002 APC-dependent impairment of T cell proliferation in aging: role of CD28- and IL-12/IL-15-mediated signaling.
12270766 2002 The role of interleukin-12, and tissue antioxidants in chronic sinusitis.
12241719 2002 Association of IL12B promoter polymorphism with severity of atopic and non-atopic asthma in children.
12207325 2002 Extracellular adenine nucleotides modulate cytokine production by human monocyte-derived dendritic cells: dual effect on IL-12 and stimulation of IL-10.
12202149 2002 Active cellular infection of myeloid cells is required for HIV-1-mediated suppression of interleukin-12 p40 expression.
12117918 2002 Novel 33-kilodalton lipoprotein from Mycobacterium leprae.
12117904 2002 Leishmania priming of human dendritic cells for CD40 ligand-induced interleukin-12p70 secretion is strain and species dependent.
12100467 2002 IL-12: the role of p40 versus p75.
12086971 2002 IL-12p40 is associated with type 1 diabetes in Caucasian-American families.
12023369 2002 A receptor for the heterodimeric cytokine IL-23 is composed of IL-12Rbeta1 and a novel cytokine receptor subunit, IL-23R.
11978670 2002 IL12B polymorphism and type 1 diabetes in the Italian population: a case-control study.
11972887 2002 The IL12B gene does not confer susceptibility to coeliac disease.
11940489 2002 The interleukin-12 and interleukin-12 receptor system in normal and transformed human B lymphocytes.
11820460 2001 Influence of low molecular weight heparin (certoparin) and unfractionated heparin on the release of cytokines from human leukocytes.
11813133 2002 A polymorphism in the human UGRP1 gene promoter that regulates transcription is associated with an increased risk of asthma.
11753820 2002 Inherited interleukin-12 deficiency: IL12B genotype and clinical phenotype of 13 patients from six kindreds.
11751963 2002 Native HIV-1 Tat protein targets monocyte-derived dendritic cells and enhances their maturation, function, and antigen-specific T cell responses.
11197695 2000 Complete primary structure, chromosomal localisation, and definition of polymorphisms of the gene encoding the human interleukin-12 p40 subunit.
11196715 2000 Genetic polymorphism of IL-12 p40 gene in immune-mediated disease.
11114383 2000 Novel p19 protein engages IL-12p40 to form a cytokine, IL-23, with biological activities similar as well as distinct from IL-12.
11110796 2001 Induction of nitric-oxide synthase and activation of NF-kappaB by interleukin-12 p40 in microglial cells.
11023671 2000 Ovine interleukin 12 has biological activity on ovine and human activated peripheral blood mononuclear cells.
10899108 2000 Charged residues dominate a unique interlocking topography in the heterodimeric cytokine interleukin-12.
10890924 2000 The role of antigen and IL-12 in sustaining Th1 memory cells in vivo: IL-12 is required to maintain memory/effector Th1 cells sufficient to mediate protection to an infectious parasite challenge.
10419056 Construction and characterization of a recombinant adenoviral vector expressing human interleukin-12.
10320373 1999 Requirement for type 2 NO synthase for IL-12 signaling in innate immunity.
10207176 1999 Recombinant human interleukin-12 is the second example of a C-mannosylated protein.
9854038 1998 Inherited interleukin 12 deficiency in a child with bacille Calmette-Guérin and Salmonella enteritidis disseminated infection.
9789052 1998 Interleukin 12 deficiency associated with recurrent infections.
9700192 1998 Genome-wide search for asthma susceptibility loci in a founder population. The Collaborative Study on the Genetics of Asthma.
9671213 1998 HIV type 1 Tat protein inhibits interleukin 12 production by human peripheral blood mononuclear cells.
9603733 1998 Severe mycobacterial and Salmonella infections in interleukin-12 receptor-deficient patients.
9603732 1998 Impairment of mycobacterial immunity in human interleukin-12 receptor deficiency.
9516412 1998 Involvement of dihydropyridine-sensitive calcium channels in human dendritic cell function. Competition by HIV-1 Tat.
8992506 1996 UVB induces IL-12 transcription in human keratinocytes in vivo and in vitro.
8799158 1996 Local production of the p40 subunit of interleukin 12 suppresses T-helper 1-mediated immune responses and prevents allogeneic myoblast rejection.
8760829 1996 Ligation of CD40 on dendritic cells triggers production of high levels of interleukin-12 and enhances T cell stimulatory capacity: T-T help via APC activation.
8551218 1996 The interleukin 12 p40 gene promoter is primed by interferon gamma in monocytic cells.
7903063 1993 Differential effects of IL12 and IL2 on expression and function of cellular adhesion molecules on purified human natural killer cells.
7843232 1995 Mouse interleukin-12 (IL-12) p40 homodimer: a potent IL-12 antagonist.
7836910 1995 Stimulatory and inhibitory effects of interleukin (IL)-4 and IL-13 on the production of cytokines by human peripheral blood mononuclear cells: priming for IL-12 and tumor necrosis factor alpha production.
7698768 1994 High-resolution physical mapping of human 5q31-q33 using three methods: radiation hybrid mapping, interphase fluorescence in situ hybridization, and pulsed-field gel electrophoresis.
7695626 1995 Differential expression of cytokine genes in HIV-1 tat transfected T and B cell lines.
7565674 1995 Regulation of interleukin 12 p40 expression through an NF-kappa B half-site.
7527811 1995 Human IL-12 p40 homodimer binds to the IL-12 receptor but does not mediate biologic activity.
7527439 1994 IL-12 is expressed and released by human keratinocytes and epidermoid carcinoma cell lines.
2204066 1990 Purification to homogeneity and partial characterization of cytotoxic lymphocyte maturation factor from human B-lymphoblastoid cells.
2070420 1991 Homology of the p40 subunit of natural killer cell stimulatory factor (NKSF) with the extracellular domain of the interleukin-6 receptor.
1674604 1991 Coexpression of two distinct genes is required to generate secreted bioactive cytotoxic lymphocyte maturation factor.
1673147 1991 Cloning of cDNA for natural killer cell stimulatory factor, a heterodimeric cytokine with multiple biologic effects on T and natural killer cells.
1358798 1992 Assignment of genes encoding a unique cytokine (IL12) composed of two unrelated subunits to chromosomes 3 and 5.