Property Summary

NCBI Gene PubMed Count 330
PubMed Score 10.50
PubTator Score 357.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Atypical autism 25 3.498 1.7

Expression

 IMPC Phenotype (2)

Protein-protein Interaction (6)

Gene RIF (335)

AA Sequence

MCPARSLLLVATLVLLDHLSLARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEID      1 - 70
HEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKT     71 - 140
MNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTID    141 - 210
RVMSYLNAS                                                                 211 - 219
//

Text Mined References (332)

PMID Year Title