Property Summary

NCBI Gene PubMed Count 38
PubMed Score 9.26
PubTator Score 36.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
oligodendroglioma 1.500 1.3e-02
psoriasis -1.100 8.7e-07
tuberculosis and treatment for 3 months 1.300 5.4e-06
non-small cell lung cancer -1.180 5.1e-16
lung cancer -1.300 1.2e-04
active Crohn's disease -1.037 6.0e-03
breast carcinoma -1.300 1.8e-05
group 4 medulloblastoma -1.300 2.5e-04
posterior fossa group A ependymoma 1.900 8.3e-08
lung adenocarcinoma -1.100 4.1e-16
invasive ductal carcinoma -1.800 9.2e-05
non-inflammatory breast cancer -2.400 1.7e-07
ductal carcinoma in situ -1.300 5.9e-04
ovarian cancer -1.400 7.7e-04

Gene RIF (25)

PMID Text
26876177 Proteolysis of the IL-11R represents a molecular switch that controls the IL-11 trans-signaling pathway which is the target in intestinal tumorigenesis, lung carcinomas, and asthma.
25524575 These results indicate that IL-11Ralpha is a potential target for the development of molecular targeted therapy and noninvasive tumor imaging in human osteosarcoma.
22433466 Constructed a designer cytokine Hyper IL-11 (H11), which is exclusively composed of naturally existing components. It contains the full length sIL-11Ralpha connected with the mature IL-11 protein, and acts as an agonist on cells expressing the gp130 molec
22075555 data suggest that IL-11Ralpha-CAR T cells may represent a new therapy for patients with osteosarcoma pulmonary metastases
21982075 IL11RA promoter polymorphism--rs1061758--may be associated with the risk of papillary thyroid cancer in the Korean population.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20553623 IL11 as well as IL11RA are likely to play a role in the progression of endometrial carcinoma.
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)
18987331 IL11 inhibits human extravillous trophoblast invasion via STAT3, indicating a likely role for IL11 in the decidual restraint of EVT invasion during normal pregnancy.
18941632 binding site of il-11 to IL-11R alpha is characterized
17332920 The objectives of this study were to clarify the role of IL-11 and IL-11Ralpha in human gastric carcinoma.
16964382 IL-11/IL-11R pathway plays an important role in the progression of colorectal adenocarcinoma.
16614887 High interleukin 11 receptor is associated with breast cancer
16291580 High expression of interleukin-11 receptor alpha is associated with Hodgkin's lymphoma
15512823 interleukin-11 receptor is expressed in CD38-positive cells from patients with multiple myeloma
14744752 IL-11Ralpha is a candidate target for translational clinical trials against advanced and metastatic prostate cancer.
14701802 the interleukin-11 receptor alpha-chain has evidence of antiapoptotic effects in human colonic epithelial cells
12569176 expression and function in human endometrium
12200462 IL-11Ralpha was expressed in both epithelial and stromal cells, with epithelial staining being more intense
11498264 Observational study of gene-disease association. (HuGE Navigator)
11315919 Observational study of gene-disease association. (HuGE Navigator)
11241561 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSSSCSGLSRVLVAVATALVSASSPCPQAWGPPGVQYGQPGRSVKLCCPGVTAGDPVSWFRDGEPKLLQG      1 - 70
PDSGLGHELVLAQADSTDEGTYICQTLDGALGGTVTLQLGYPPARPVVSCQAADYENFSCTWSPSQISGL     71 - 140
PTRYLTSYRKKTVLGADSQRRSPSTGPWPCPQDPLGAARCVVHGAEFWSQYRINVTEVNPLGASTRLLDV    141 - 210
SLQSILRPDPPQGLRVESVPGYPRRLRASWTYPASWPCQPHFLLKFRLQYRPAQHPAWSTVEPAGLEEVI    211 - 280
TDAVAGLPHAVRVSARDFLDAGTWSTWSPEAWGTPSTGTIPKEIPAWGQLHTQPEVEPQVDSPAPPRPSL    281 - 350
QPHPRLLDHRDSVEQVAVLASLGILSFLGLVAGALALGLWLRLRRGGKDGSPKPGFLASVIPVDRRPGAP    351 - 420
NL                                                                        421 - 422
//

Text Mined References (39)

PMID Year Title
26876177 2016 Proteolytic Cleavage Governs Interleukin-11 Trans-signaling.
25524575 2015 Interleukin-11 receptor ? is overexpressed in human osteosarcoma, and near-infrared-labeled IL-11R? imaging agent could detect osteosarcoma in mouse tumor xenografts.
22433466 2012 A designer hyper interleukin 11 (H11) is a biologically active cytokine.
22075555 2012 Genetically modified T cells targeting interleukin-11 receptor ?-chain kill human osteosarcoma cells and induce the regression of established osteosarcoma lung metastases.
21982075 2012 Associations between promoter polymorphism -106A/G of interleukin-11 receptor alpha and papillary thyroid cancer in Korean population.
21741611 2011 Inactivation of IL11 signaling causes craniosynostosis, delayed tooth eruption, and supernumerary teeth.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20553623 2010 Interleukin 11 is upregulated in uterine lavage and endometrial cancer cells in women with endometrial carcinoma.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
18987331 2009 Interleukin 11 inhibits human trophoblast invasion indicating a likely role in the decidual restraint of trophoblast invasion during placentation.
18941632 2008 A ligand peptide motif selected from a cancer patient is a receptor-interacting site within human interleukin-11.
17332920 2007 Expression of interleukin-11 (IL-11) and IL-11 receptor alpha in human gastric carcinoma and IL-11 upregulates the invasive activity of human gastric carcinoma cells.
16964382 2006 Expression of interleukin (IL)-11 and IL-11 receptor in human colorectal adenocarcinoma: IL-11 up-regulation of the invasive and proliferative activity of human colorectal carcinoma cells.
16614887 2006 Expression of interleukin 11 and its receptor and their prognostic value in human breast cancer.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16291580 2006 Gene expression profile of cytokines and chemokines in microdissected primary Hodgkin and Reed-Sternberg (HRS) cells: high expression of interleukin-11 receptor alpha.
15512823 2004 Expression of interleukin-11 receptor in CD38-positive cells from patients with multiple myeloma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14744752 2004 Combinatorial screenings in patients: the interleukin-11 receptor alpha as a candidate target in the progression of human prostate cancer.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14701802 2004 Functional expression of the interleukin-11 receptor alpha-chain and evidence of antiapoptotic effects in human colonic epithelial cells.
12569176 2003 Expression and function of interleukin-11 and its receptor alpha in the human endometrium.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12200462 2002 Expression of interleukin (IL)-11 receptor by the human endometrium in vivo and effects of IL-11, IL-6 and LIF on the production of MMP and cytokines by human endometrial cells in vitro.
11498264 2001 Genetic polymorphisms of IL-1beta and IL-1 receptor antagonist in association with multiple sclerosis in Japanese patients.
11315919 2001 Cytokine gene polymorphisms and susceptibility to juvenile idiopathic arthritis. British Paediatric Rheumatology Study Group.
11241561 2001 Polymorphisms of the IL-1 gene complex in coal miners with silicosis.
11181995 2001 The sequence of the human genome.
11141475 2001 Increased expression of the interleukin-11 receptor and evidence of STAT3 activation in prostate carcinoma.
10504396 1999 Definition of receptor binding sites on human interleukin-11 by molecular modeling-guided mutagenesis.
10026196 1999 Identification of three distinct receptor binding sites of murine interleukin-11.
9632650 1998 Cotranscription and intergenic splicing of human galactose-1-phosphate uridylyltransferase and interleukin-11 receptor alpha-chain genes generate a fusion mRNA in normal cells. Implication for the production of multidomain proteins during evolution.
8808281 1996 Molecular cloning and characterization of the human interleukin-11 receptor alpha-chain gene, IL11RA, located on chromosome 9p13.
8786120 1996 The human interleukin-11 receptor alpha gene (IL11RA): genomic organization and chromosome mapping.
7670098 1995 Molecular cloning of two isoforms of a receptor for the human hematopoietic cytokine interleukin-11.