Property Summary

NCBI Gene PubMed Count 73
PubMed Score 55.53
PubTator Score 65.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
glioblastoma 1.300 3.0e-07
lung cancer -1.300 1.4e-02
diabetes mellitus -1.600 1.6e-03
pediatric high grade glioma 1.300 1.1e-05
group 3 medulloblastoma 1.100 6.2e-03
pilocytic astrocytoma 1.300 9.0e-07
posterior fossa group A ependymoma 1.100 4.3e-07
subependymal giant cell astrocytoma 1.546 1.0e-02
ovarian cancer -1.400 2.0e-06

 GO Function (1)

Protein-protein Interaction (10)

Gene RIF (53)

PMID Text
26130064 IL10R2 Overexpression promotes IL22/STAT3 signaling in colorectal carcinogenesis.
25733167 High IL10RB expression is associated with diffuse large B-cell lymphoma.
25373860 genetic association study in cohort of infants/children: Data suggest perianal fistulas are exhibited in patients with very early-onset inflammatory bowel disease with IL10 receptor mutations (IL10RA/B); prognosis and response to treatment are poor.
25032264 PAPL, IL10RB and DEPDC5 polymorphisms have an impact on progression of hepatitis B virus-related liver disease.
24785691 Inflammatory bowel disease (IBD) in infancy is phenotypically and genetically different disease entity from adult-onset or older child-onset IBD. It has a strong association with IL-10 receptor gene.
24581234 No evidence for an involvement of autoantibodies against IL-10 or IL-10R in the pathogenesis of inflammatory bowel disease could be established.
24379584 Case Report: pediatric ulcerative colitis patient compound heterozygote for the IL10RB E47K polymorphism, inherited from his father.
24216686 Mutations in the IL10RB gene is associated with ulcerative colitis.
24144988 Results show that the distribution of IL10RB and IL28RA genotypes among the Hepatitis C virus-infected and control groups did not differ significantly.
24089328 5 patients with an IL-10R1 or IL-10R2 deficiency developed B-cell non-Hodgkin lymphoma between the ages of 5 and 6 years (which was recurrent in 1 patient).
23749100 IL-10RB rs2834167 (A/G) polymorphism may be a potential biomarker for susceptibility to systemic lupus erythematosus.
23745570 The effects of two functional polymorphisms, type I interferon receptor 2 gene (IFNAR2)-F8S and interleukin-10 receptor subunit beta gene (IL10RB)-K47E, on chronic hepatitis B virus (HBV) infection, were investigated.
23096091 Single nucleotide polymorphisms in the IL10, IL10RA, and IL10RB genes may contribute to hypertension in the risk of ischemic stroke in the Korean population.
22550014 IL10RB polymorphisms are associated with Crohn's disease.
22549091 Of 66 patients with infantile (very early onset) inflammatory bowel disease, 16 had IL-10 or IL-10R deficiency: 3 patients had mutations in IL-10, 5 had mutations in IL-10R1, and 8 had mutations in IL-10R2.
21814839 The haplotype -185/-116 of IL10 receptor alpha in combination with the haplotype -754/-750 of IL10 receptor beta contributed towards mild malaria.
21532858 It is concluded that there is a strong association between the IL10 and IL10RB SNPs, and BPH in Korean population
20976276 Observational study of gene-disease association. (HuGE Navigator)
20811626 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20800603 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20568250 Observational study of gene-disease association. (HuGE Navigator)
20503287 Observational study of gene-disease association. (HuGE Navigator)
20424473 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20140262 Observational study of gene-disease association. (HuGE Navigator)
20087947 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19890111 Mutations in genes encoding the IL10R subunit proteins were found in patients with early-onset enterocolitis, involving hyperinflammatory immune responses in the intestine.
19773451 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
19714778 The association with the susceptibility to HBV infection was only observed for IL10RB K47E when we compared the individuals with persistent HBV infection through nonmaternal transmission to the controls with asymptomatic self-limited HBV infection.
19577285 Inhibition of S100A11 gene expression impairs the ability of keratinocytes to control vaccinia virus replication via downregulation of IFN-lambda receptor IL-10R2.
19573080 Observational study of gene-disease association. (HuGE Navigator)
19527514 Observational study of gene-disease association. (HuGE Navigator)
19409109 gene polymorphism in combination with IL-10 gene polymorphism is assiociated with GvHD in HLA-identical donor-recipient pairs
19295315 Observational study of gene-disease association. (HuGE Navigator)
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19019335 Observational study of gene-disease association. (HuGE Navigator)
18818748 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18715339 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18675824 The IL-22R and IL-10R2 binding sites are juxtaposed on adjacent IL-22 surfaces contributed mostly by helices A, D, and F and loop AB.
18674658 Data demonstrate a significant relation between cervical concentrations of IL-10 and single nucleotide polymorphisms in the IL-10 receptor alpha and beta genes.
18674658 Observational study of gene-disease association. (HuGE Navigator)
18588853 These findings suggested that signaling through IL-10R2 may play a causative role in dcSSc.
18588853 Observational study of gene-disease association. (HuGE Navigator)
17703412 Observational study of gene-disease association. (HuGE Navigator)
17152005 Observational study of gene-disease association. (HuGE Navigator)
17062437 data suggest that despite normal levels of IL-10R expression, and an apparent lack of abnormalities in intracellular signals induced through this receptor, immune cells from SLE patients exhibit aberrant pattern of gene expression induced through IL-10R
16109775 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15985167 model of the ternary complex of interleukin-10 with its soluble receptors
15178681 sensitivity to recombinant interleukin-26(IL-26) of various cell lines strictly correlated with the expression of IL-20 receptor 1 and blocking antibodies against either IL-10 receptor 2 or IL-20 receptor 1 inhibited IL-26-dependent signal transduction
12483210 distinct receptor complex that is utilized by all three IFN-lambda proteins for signaling and is composed of two subunits, a receptor designated CRF2-12 (also designated as IFN-lambdaR1) and a second subunit, CRF2-4 (also known as IL-10R2)

AA Sequence

MAWSLGSWLGGCLLVSALGMVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTT      1 - 70
LTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEY     71 - 140
ETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCE    141 - 210
QTTHDETVPSWMVAVILMASVFMVCLALLGCFALLWCVYKKTKYAFSPRNSLPQHLKEFLGHPHHNTLLF    211 - 280
FSFPLSDENDVFDKLSVIAEDSESGKQNPGDSCSLGTPPGQGPQS                             281 - 325
//

Text Mined References (77)

PMID Year Title
26130064 2015 IL10R2 Overexpression Promotes IL22/STAT3 Signaling in Colorectal Carcinogenesis.
25733167 2015 IL10 receptor is a novel therapeutic target in DLBCLs.
25373860 2015 Clinical features of interleukin 10 receptor gene mutations in children with very early-onset inflammatory bowel disease.
25032264 2014 Role of IFN-ks, IFN-ks related genes and the DEPDC5 gene in Hepatitis B virus-related liver disease.
24785691 2014 Very early-onset inflammatory bowel disease (IBD) in infancy is a different disease entity from adult-onset IBD; one form of interleukin-10 receptor mutations.
24581234 2014 Evidence for non-neutralizing autoantibodies against IL-10 signalling components in patients with inflammatory bowel disease.
24379584 2013 Synergistic effect of interleukin-10-receptor variants in a case of early-onset ulcerative colitis.
24216686 2013 Phenotypic characterization of very early-onset IBD due to mutations in the IL10, IL10 receptor alpha or beta gene: a survey of the Genius Working Group.
24204295 2013 Genome wide analysis of narcolepsy in China implicates novel immune loci and reveals changes in association prior to versus after the 2009 H1N1 influenza pandemic.
24144988 2014 Evaluation of the relationship between IL28B, IL10RB and IL28RA single-nucleotide polymorphisms and susceptibility to hepatitis C virus in Chinese Han population.
24089328 2013 A Mendelian predisposition to B-cell lymphoma caused by IL-10R deficiency.
23749100 2013 IL-10RB rs2834167 (A/G) polymorphism is associated with the susceptibility to systemic lupus erythematosus: evidence from a study in Chinese Han population.
23745570 2013 Association of IFNAR2 and IL10RB genes in chronic hepatitis B virus infection.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23096091 2013 Association between IL10, IL10RA, and IL10RB SNPs and ischemic stroke with hypertension in Korean population.
22550014 2013 IL-10R polymorphisms are associated with very-early-onset ulcerative colitis.
22549091 2012 Loss of interleukin-10 signaling and infantile inflammatory bowel disease: implications for diagnosis and therapy.
21814839 2012 Combined promoter haplotypes of the IL10R genes are associated with protection against severe malaria in Gabonese children.
21532858 2011 Association of IL10, IL10RA, and IL10RB polymorphisms with benign prostate hyperplasia in Korean population.
20976276 2010 Interleukin-10 (IL-10) pathway: genetic variants and outcomes of HIV-1 infection in African American adolescents.
20811626 2010 Genetic variants in inflammation-related genes are associated with radiation-induced toxicity following treatment for non-small cell lung cancer.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20568250 2010 Common single nucleotide polymorphisms in immunoregulatory genes and multiple myeloma risk among women in Connecticut.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20462497 2010 Structure and mechanism of receptor sharing by the IL-10R2 common chain.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20140262 2010 Maternal and fetal genetic associations of PTGER3 and PON1 with preterm birth.
20087947 2010 Association of candidate susceptible loci with chronic infection with hepatitis B virus in a Chinese population.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19890111 2009 Inflammatory bowel disease and mutations affecting the interleukin-10 receptor.
19773451 2009 Role of inflammation gene polymorphisms on pain severity in lung cancer patients.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19714778 2009 Association study of IFNAR2 and IL10RB genes with the susceptibility and interferon response in HBV infection.
19577285 2009 Inhibition of S100A11 gene expression impairs keratinocyte response against vaccinia virus through downregulation of the IL-10 receptor 2 chain.
19573080 2009 Common genetic variants in candidate genes and risk of familial lymphoid malignancies.
19527514 2009 Racial disparity in pathophysiologic pathways of preterm birth based on genetic variants.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19409109 2009 Association of IL-10 and IL-10Rbeta gene polymorphisms with graft-versus-host disease after haematopoietic stem cell transplantation from an HLA-identical sibling donor.
19295315 2009 IL10 and IL10 receptor gene variation and outcomes after unrelated and related hematopoietic cell transplantation.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19019335 2009 Spontaneous preterm birth in African Americans is associated with infection and inflammatory response gene variants.
18818748 2008 Preterm birth in Caucasians is associated with coagulation and inflammation pathway gene variants.
18715339 2008 Associations between cytokine/cytokine receptor single nucleotide polymorphisms and humoral immunity to measles, mumps and rubella in a Somali population.
18675824 2008 IL-22R, IL-10R2, and IL-22BP binding sites are topologically juxtaposed on adjacent and overlapping surfaces of IL-22.
18674658 2008 Genetic regulation of cervical antiinflammatory cytokine concentrations during pregnancy.
18588853 2008 Association of IL-10 receptor 2 (IL10RB) SNP with systemic sclerosis.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17567994 2007 Prominent use of distal 5' transcription start sites and discovery of a large number of additional exons in ENCODE regions.
17152005 2007 Associations between measles vaccine immunity and single-nucleotide polymorphisms in cytokine and cytokine receptor genes.
17062437 Expression and function of IL-10R in mononuclear cells from patients with systemic lupus erythematosus.
16757563 2006 Class II cytokine receptor gene cluster is a major locus for hepatitis B persistence.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16109775 2005 Genetic variation in the IL-10 pathway modulates severity of acute graft-versus-host disease following hematopoietic cell transplantation: synergism between IL-10 genotype of patient and IL-10 receptor beta genotype of donor.
15985167 2005 A model of the ternary complex of interleukin-10 with its soluble receptors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15178681 2004 The T-cell lymphokine interleukin-26 targets epithelial cells through the interleukin-20 receptor 1 and interleukin-10 receptor 2 chains.
15123776 2004 The expanded family of class II cytokines that share the IL-10 receptor-2 (IL-10R2) chain.
15120653 2004 Temporal associations between interleukin 22 and the extracellular domains of IL-22R and IL-10R2.
12483210 2003 IFN-lambdas mediate antiviral protection through a distinct class II cytokine receptor complex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12469119 2003 IL-28, IL-29 and their class II cytokine receptor IL-28R.
11485736 2001 Crystal structure of the IL-10/IL-10R1 complex reveals a shared receptor binding site.
11450494 2001 The influence of pro-inflammatory cytokines on human retinal pigment epithelium cell receptors.
11416224 2001 Identification of urocortin III, an additional member of the corticotropin-releasing factor (CRF) family with high affinity for the CRF2 receptor.
10954742 2000 Human interleukin-10-related T cell-derived inducible factor: molecular cloning and functional characterization as an hepatocyte-stimulating factor.
10875937 2000 Interleukin (IL)-22, a novel human cytokine that signals through the interferon receptor-related proteins CRF2-4 and IL-22R.
10830953 2000 The DNA sequence of human chromosome 21.
10077530 1999 Comparative genomic analysis of the interferon/interleukin-10 receptor gene cluster.
9463407 1998 The orphan receptor CRF2-4 is an essential subunit of the interleukin 10 receptor.
9312047 1997 Identification and functional characterization of a second chain of the interleukin-10 receptor complex.
9047351 1997 CRF2-4: isolation of cDNA clones encoding the human and mouse proteins.
8314576 1993 A new member of the cytokine receptor gene family maps on chromosome 21 at less than 35 kb from IFNAR.
7563119 1995 Structure of the human CRFB4 gene: comparison with its IFNAR neighbor.