Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00
PubTator Score 20.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
acute myeloid leukemia 1.100 2.1e-02
astrocytic glioma 1.100 8.3e-03
atypical teratoid / rhabdoid tumor 1.100 3.5e-06
glioblastoma 1.200 9.3e-05
medulloblastoma, large-cell 1.600 8.6e-06
osteosarcoma 1.053 5.8e-03
ovarian cancer -1.400 1.2e-05

 IMPC Phenotype (1)

AA Sequence

MGEKKPEPLDFVKDFQEYLTQQTHHVNMISGSVSGDKEAEALQGAGTDGDQNGLDHPSVEVSLDENSGML      1 - 70
VDGFERTFDGKLKCRYCNYASKGTARLIEHIRIHTGEKPHRCHLCPFASAYERHLEAHMRSHTGEKPYKC     71 - 140
ELCSFRCSDRSNLSHHRRRKHKMVPIKGTRSSLSSKKMWGVLQKKTSNLGYSRRALINLSPPSMVVQKPD    141 - 210
YLNDFTHEIPNIQTDSYESMAKTTPTGGLPRDPQELMVDNPLNQLSTLAGQLSSLPPENQNPASPDVVPC    211 - 280
PDEKPFMIQQPSTQAVVSAVSASIPQSSSPTSPEPRPSHSQRNYSPVAGPSSEPSAHTSTPSIGNSQPST    281 - 350
PAPALPVQDPQLLHHCQHCDMYFADNILYTIHMGCHGYENPFQCNICGCKCKNKYDFACHFARGQHNQH     351 - 419
//

Text Mined References (12)

PMID Year Title