Property Summary

NCBI Gene PubMed Count 35
PubMed Score 14.96
PubTator Score 92.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Gene RIF (23)

PMID Text
26495986 The results show that high vs. low expression of Nrp-1 or Helios does not unequivocally identify Treg clones of thymic or peripheral origin.
25586548 Helios could be considered a more reliable marker for distinguishing thymic derived Regulatory T (tTreg) cells or peripherally induced Treg cells than Nrp1.
25446972 The immunosuppressive enzyme IL4I1 expressed differentially in human induced Aiolos+, but not natural Helios+, FOXP3+ Treg cells.
25425428 Forkhead box protein 3(+) regulatory T cells and Helios(+) subset in perinatally acquired HIV.
25008482 expression is not affected in diGeorge syndrome
23600753 Ectopic expression of ATL-type Helios isoform as well as knockdown of normal Helios or Ikaros promoted T-cell growth.
23409157 large number of ex vivo expanded functional Treg can be obtained from long-term T1D patients, although fewer expanded Treg expressed a high level of Helios
23365462 A differential role for monocyte subsets in control of Helios(+/-) Treg development that is mediated by distinct inflammatory cytokines.
23359504 Helios+ and Helios- cells coexist within the natural FOXP3+ T regulatory cell subset in humans.
23264341 Foxp3+ Helios+ regulatory T cells are expanded in active systemic lupus erythematosus.
22931634 Although Ikaros and Helios belong to the same family with similar structure of zinc fingers, their isoforms have different expression profiles, specific genetic alterations, and different clinical relevance in patients with leukemia.
22753928 Presence of Helios-positive regulatory T (Treg) cells may maintain susceptibility to helminth infection on the C57BL/6 mouse background.
21918685 Data found that Helios-negative T cells are enriched for naive T cell phenotypes and vice versa. Moreover, Helios can be induced during T cell activation and proliferation, but regresses in the same cells under resting conditions.
21570917 Expanded peripheral FoxP3+ Tregs in untreated renal cell carcinoma patients co-express Helios. Interestingly, IL-2 administration results in expansion of FoxP3+Helios+ natural Tregs (nTregs) significantly more than FoxP3+Helios- iTregs.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20432734 distribution of positive and negative expression of Aiolos and Helios found in various types of leukemias could implicate common pathways of their regulation
20226531 found that suppression of Helios message in CD4(+)CD25(+) T cells significantly attenuates their suppressive function.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19860791 Observational study of gene-disease association. (HuGE Navigator)
18332232 showed Aiolos overexpression in primary lymphoma tissue
17681952 the NuRD complex makes major contributions to the functions of both Ikaros and Helios and the activities of these proteins may be regulated in part by changes in phosphorylation
17297655 suggest a critical role for Helios in the mechanism of leukemogenesis
11937265 Novel short isoforms of Helios are overexpressed in a patient with T-cell acute lymphoblastic leukemia and may contribute to the development of T-cell malignancies. Data for unaltered Helios indicates tumor suppressor function.

AA Sequence

METEAIDGYITCDNELSPEREHSNMAIDLTSSTPNGQHASPSHMTSTNSVKLEMQSDEECDRKPLSREDE      1 - 70
IRGHDEGSSLEEPLIESSEVADNRKVQELQGEGGIRLPNGKLKCDVCGMVCIGPNVLMVHKRSHTGERPF     71 - 140
HCNQCGASFTQKGNLLRHIKLHSGEKPFKCPFCSYACRRRDALTGHLRTHSVGKPHKCNYCGRSYKQRSS    141 - 210
LEEHKERCHNYLQNVSMEAAGQVMSHHVPPMEDCKEQEPIMDNNISLVPFERPAVIEKLTGNMGKRKSST    211 - 280
PQKFVGEKLMRFSYPDIHFDMNLTYEKEAELMQSHMMDQAINNAITYLGAEALHPLMQHPPSTIAEVAPV    281 - 350
ISSAYSQVYHPNRIERPISRETADSHENNMDGPISLIRPKSRPQEREASPSNSCLDSTDSESSHDDHQSY    351 - 420
QGHPALNPKRKQSPAYMKEDVKALDTTKAPKGSLKDIYKVFNGEGEQIRAFKCEHCRVLFLDHVMYTIHM    421 - 490
GCHGYRDPLECNICGYRSQDRYEFSSHIVRGEHTFH                                      491 - 526
//

Text Mined References (38)

PMID Year Title
26495986 2015 Differences in Expression Level of Helios and Neuropilin-1 Do Not Distinguish Thymus-Derived from Extrathymically-Induced CD4+Foxp3+ Regulatory T Cells.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25586548 2015 Concomitant analysis of Helios and Neuropilin-1 as a marker to detect thymic derived regulatory T cells in naïve mice.
25446972 2015 Differential expression of the immunosuppressive enzyme IL4I1 in human induced Aiolos+, but not natural Helios+, FOXP3+ Treg cells.
25425428 2015 Forkhead box protein 3(+) regulatory T cells and Helios(+) subset in perinatally acquired HIV.
25416956 2014 A proteome-scale map of the human interactome network.
25008482 2014 Helios expression in T-regulatory cells in patients with di George Syndrome.
23600753 2013 Adult T-cell leukemia cells are characterized by abnormalities of Helios expression that promote T cell growth.
23409157 2013 Foxp3+ Treg expanded from patients with established diabetes reduce Helios expression while retaining normal function compared to healthy individuals.
23365462 2013 Differential control of Helios(+/-) Treg development by monocyte subsets through disparate inflammatory cytokines.
23359504 2013 Helios+ and Helios- cells coexist within the natural FOXP3+ T regulatory cell subset in humans.
23264341 2013 Foxp3+ Helios+ regulatory T cells are expanded in active systemic lupus erythematosus.
23088713 2012 Protein interactions of the transcription factor Hoxa1.
22931634 2012 [Expression characteristics of isoforms of Ikaros and Helios in patients with leukemia and their mechanism].
22753928 2012 Cutting edge: in the absence of TGF-? signaling in T cells, fewer CD103+ regulatory T cells develop, but exuberant IFN-? production renders mice more susceptible to helminth infection.
21918685 2011 Helios expression is a marker of T cell activation and proliferation.
21570917 2011 Expanded subpopulation of FoxP3+ T regulatory cells in renal cell carcinoma co-express Helios, indicating they could be derived from natural but not induced Tregs.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20432734 2010 Analysis of Ikaros family splicing variants in human hematopoietic lineages.
20226531 2010 A role for the transcription factor Helios in human CD4(+)CD25(+) regulatory T cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19860791 2010 Genetic evidence for a role of IL33 in nasal polyposis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19198610 2009 Sequence variants affecting eosinophil numbers associate with asthma and myocardial infarction.
18332232 2008 Aberrant Ikaros, Aiolos, and Helios expression in Hodgkin and non-Hodgkin lymphoma.
17681952 2007 Predominant interaction of both Ikaros and Helios with the NuRD complex in immature thymocytes.
17297655 2007 Characterization of the short isoform of Helios overexpressed in patients with T-cell malignancies.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12752680 2003 Ikaros, Aiolos and Helios: transcription regulators and lymphoid malignancies.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12153174 2002 Expression of a unique helios isoform in human leukemia cells.
12115658 2002 Identification and expression of Helios, a member of the Ikaros family, in the Mexican axolotl: implications for the embryonic origin of lymphocyte progenitors.
11937265 2002 Overexpression of novel short isoforms of Helios in a patient with T-cell acute lymphoblastic leukemia.
10978333 2000 Eos and pegasus, two members of the Ikaros family of proteins with distinct DNA binding activities.
10541817 1999 Human Helios, an Ikaros-related zinc finger DNA binding protein: cDNA cloning and tissue expression pattern.
9560339 1998 Helios, a novel dimerization partner of Ikaros expressed in the earliest hematopoietic progenitors.
9512513 1998 Helios, a T cell-restricted Ikaros family member that quantitatively associates with Ikaros at centromeric heterochromatin.