Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.00
PubTator Score 0.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
active Crohn's disease 2.091 4.1e-03
adrenocortical carcinoma 1.834 3.5e-06
adult high grade glioma 1.800 1.5e-04
Astrocytoma, Pilocytic 1.800 1.1e-05
atypical teratoid / rhabdoid tumor 2.800 1.4e-06
ependymoma 1.600 1.7e-05
gastric carcinoma 1.600 1.4e-02
glioblastoma 2.200 2.1e-08
group 3 medulloblastoma 2.000 7.3e-04
hepatocellular carcinoma 1.100 3.8e-04
interstitial cystitis 1.100 3.6e-05
medulloblastoma, large-cell 1.100 3.0e-02
osteosarcoma 2.361 1.4e-06
ovarian cancer 2.600 1.4e-04
pancreatic cancer 1.100 3.0e-02
pancreatic carcinoma 1.100 3.0e-02
pituitary cancer -1.700 3.3e-06
primitive neuroectodermal tumor 1.900 2.7e-03
sarcoidosis 1.100 5.9e-03
ulcerative colitis 2.700 4.5e-07

Gene RIF (2)

AA Sequence

MSEVKSRKKSGPKGAPAAEPGKRSEGGKTPVARSSGGGGWADPRTCLSLLSLGTCLGLAWFVFQQSEKFA      1 - 70
KVENQYQLLKLETNEFQQLQSKISLISEKWQKSEAIMEQLKSFQIIAHLKRLQEEINEVKTWSNRITEKQ     71 - 140
DILNNSLTTLSQDITKVDQSTTSMAKDVGLKITSVKTDIRRISGLVTDVISLTDSVQELENKIEKVEKNT    141 - 210
VKNIGDLLSSSIDRTATLRKTASENSQRINSVKKTLTELKSDFDKHTDRFLSLEGDRAKVLKTVTFANDL    211 - 280
KPKVYNLKKDFSRLEPLVNDLTLRIGRLVTDLLQREKEIAFLSEKISNLTIVQAEIKDIKDEIAHISDMN    281 - 350
//

Text Mined References (10)

PMID Year Title