Property Summary

NCBI Gene PubMed Count 22
PubMed Score 96.85
PubTator Score 73.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
uncontrolled asthma -1.200 4.3e-02
osteosarcoma -1.833 1.0e-07
diabetes mellitus 1.900 1.1e-03
posterior fossa group B ependymoma 1.200 1.7e-06
ovarian cancer -1.400 5.0e-05
chronic rhinosinusitis -1.318 1.4e-02
dermatomyositis 1.100 7.2e-04

Synonym

Accession Q13123 Q6IPD8
Symbols RED
RER
CSA2

Gene

IK

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

Gene RIF (10)

PMID Text
25277267 Data suggest an indirect radiosensitivity of hIK channels to low-dose photon irradiation with an impact on cell differentiation.
24996188 IK is an essential protein for achieving correct mitotic progress through the regulation of mitotic kinases and phosphatases
24945353 Data suggest that two human spliceosomal factors, RED and SMU1, are recruited to control expression and alternative splicing of viral exportins via PB2 (polymerase PB2) of influenza A virus (H3N2) and are required for efficient viral multiplication.
22351768 RED is required for kinetochore localization of MAD1, mitotic progression, and activation of the spindle assembly checkpoint.
22190034 HIV-1 Rev is identified to have a physical interaction with IK cytokine, down-regulator of HLA II (IK; RED) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21509594 IK gene expression is decreased in follicular variant of papillary thyroid carcinoma.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19845895 Observational study of gene-disease association. (HuGE Navigator)
19064678 At least three genes, orthologous to loci in this LD block, HBEGF, IK, and SRA1, result independently in a phenotype of myocardial contractile dysfunction when their expression is reduced with morpholino antisense reagents.

AA Sequence

MPERDSEPFSNPLAPDGHDVDDPHSFHQSKLTNEDFRKLLMTPRAAPTSAPPSKSRHHEMPREYNEDEDP      1 - 70
AARRRKKKSYYAKLRQQEIERERELAEKYRDRAKERRDGVNKDYEETELISTTANYRAVGPTAEADKSAA     71 - 140
EKRRQLIQESKFLGGDMEHTHLVKGLDFALLQKVRAEIASKEKEEEELMEKPQKETKKDEDPENKIEFKT    141 - 210
RLGRNVYRMLFKSKAYERNELFLPGRMAYVVDLDDEYADTDIPTTLIRSKADCPTMEAQTTLTTNDIVIS    211 - 280
KLTQILSYLRQGTRNKKLKKKDKGKLEEKKPPEADMNIFEDIGDYVPSTTKTPRDKERERYRERERDRER    281 - 350
DRDRDRERERERDRERERERDREREEEKKRHSYFEKPKVDDEPMDVDKGPGSTKELIKSINEKFAGSAGW    351 - 420
EGTESLKKPEDKKQLGDFFGMSNSYAECYPATMDDMAVDSDEEVDYSKMDQGNKKGPLGRWDFDTQEEYS    421 - 490
EYMNNKEALPKAAFQYGIKMSEGRKTRRFKETNDKAELDRQWKKISAIIEKRKKMEADGVEVKRPKY       491 - 557
//

Text Mined References (32)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25277267 2015 Low-dose photon irradiation alters cell differentiation via activation of hIK channels.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24996188 2014 Depletion of IK causes mitotic arrest through aberrant regulation of mitotic kinases and phosphatases.
24945353 2014 Recruitment of RED-SMU1 complex by Influenza A Virus RNA polymerase to control Viral mRNA splicing.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
22351768 2012 RED, a spindle pole-associated protein, is required for kinetochore localization of MAD1, mitotic progression, and activation of the spindle assembly checkpoint.
22190034 2011 Global landscape of HIV-human protein complexes.
21509594 2011 Differential expression of a set of genes in follicular and classic variants of papillary thyroid carcinoma.
21269460 2011 Initial characterization of the human central proteome.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19845895 2009 Fine mapping of the CELIAC2 locus on chromosome 5q31-q33 in the Finnish and Hungarian populations.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19064678 2009 HBEGF, SRA1, and IK: Three cosegregating genes as determinants of cardiomyopathy.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11407974 2001 The interferon inhibiting cytokine IK is overexpressed in cutaneous T cell lymphoma derived tumor cells that fail to upregulate major histocompatibility complex class II upon interferon-gamma stimulation.
10216252 1999 Isolation, sequencing and expression of RED, a novel human gene encoding an acidic-basic dipeptide repeat.
9160666 1997 Implication of a new molecule IK in CD34+ hematopoietic progenitor cell proliferation and differentiation.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7970704 1994 A new cytokine (IK) down-regulating HLA class II: monoclonal antibodies, cloning and chromosome localization.