Property Summary

NCBI Gene PubMed Count 87
PubMed Score 390.91
PubTator Score 59.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 1.500 7.2e-05
osteosarcoma 2.035 2.8e-07
active Crohn's disease -1.540 7.9e-03
ulcerative colitis -1.400 4.8e-04

Gene RIF (69)

PMID Text
26963384 The Annexin a2 Promotes Development in Arthritis through Neovascularization by Amplification Hedgehog Pathway.
26705100 Our results show for the first time that Indian hedgehog does not cause extracellular matrix degradation in healthy ex vivo cartilage or in the presence of IL-1beta
26691363 The serum levels of IHH and SHH were significantly higher in autistic subjects than those of control subjects. The findings support a correlation between SHH, IHH and BDNF in autistic children, suggesting their pathological role in autism.
26201092 Data show that the Hh (Hedgehog) signalling pathway mediates chemoresistance of BCSCs (breast cancer stem cells) and contributes to the outcome in breast cancer patients.
25958162 Findings demonstrated that Ihh promotes human cartilage endplate degeneration.
25888497 Data suggest that hedgehog (HH) signaling through transcription factors GLI1 and GLI2 could be required for the maintenance of pregnancy.
25692887 Duplication of the upstream IHH regulatory region and a correlation between the phenotype and the implicated regulatory regions in a family with craniosynostosis Philadelphia type.
25519748 endogenously produced IHH is playing a critical role in regulating hBMSC chondrogenesis.
24991722 Studies indicate that the hedgehog (Hh) signaling pathway has become one of the most studied potential therapeutic targets in hematological malignancies.
24844414 Indian Hedgehog, a critical modulator in osteoarthritis, could be a potential therapeutic target for attenuating cartilage degeneration disease.
24786088 Increased Ihh is associated with the severity of osteoarthritis cartilage damage. Elevated Ihh content in human knee joint synovial fluid correlates with early cartilage lesions.
24344235 Data indicate that neutralizing hedgehog antibody MEDI-5304 represents a potent dual hedgehog inhibitor suitable for patients with tumors harboring elevated levels of sonic hedgehog (SHH) or indian hedgehog (IHH).
23883825 Data indicate that overexpression of Indian hedgehog (Ihh) signaling promotes abnormal chondrocyte differentiation in enchondral ossification and enhances bone formation in cervical ossification of the posterior longitudinal ligament (OPLL).
23786654 Hedgehog signaling regulates hypoxia induced epithelial to mesenchymal transition and invasion in pancreatic cancer cells via a ligand-independent manner.
23575478 Studies indicate that upregulation of Hedgehog protein has been found in tumor-associated stroma and associated with vascularization and excessive stromal expansion can limit intratumoral drug delivery.
23468532 We further indicated that SHH and IHH were highly expressed in metastatic tumors
23418531 Data indicate that analysis of public microarray data suggests that PBOV1 activation in tumors could be dependent on the Hedgehog signaling pathway.
23403897 Data indicate that compounds 7 and 9 (diterpene) showed cytotoxicity against cancer cell lines in which hedgehog (Hh) signaling was aberrantly activated.
23303278 Studies indicate that activation of the hedgehog (Hh) signaling pathway has been observed in several cancer types, including ovarian cancer.
22817660 Gene transfer of indian hedgehog protein results in chondrogenic induction of mesenchymal stem cells.
22750747 Intra-articular injection of human mesenchymal stem cells (MSCs) promote rat meniscal regeneration by being activated to express Indian hedgehog that enhances expression of type II collagen.
22507129 Ihh-induced Nkx3.2 degradation requires Wnt5a, which is capable of triggering Nkx3.2 degradation
22486854 Results suggest that hypoxia-induced increase of Smo directly contributes to the proliferation of pancreatic ductal adenocarcinoma (PDAC) cells through a hedgehog/Gli1-independent pathway.
22469853 Activation of Indian hedgehog promotes chondrocyte hypertrophy and upregulation of MMP-13 in human osteoarthritic cartilage.
22406540 A missense mutation in IHH gene is observed in an individual affected by brachydactyly type A1.
22234151 A large duplication involving the IHH locus mimics acrocallosal syndrome
22123293 Studies indicate that pathways of Hedgehog (Hh), Wnt and Notch, which regulate development during embryonic life and somatic stem cells (SCs) in the adult organism, can be reactivated in malignancies and support tumor-initiating cells (TIC) scompartment.
21642379 Studies indicate that IHH is required for normal chondrocyte proliferation during both embryonic and postnatal growth.
21640343 Nuclear and cytoplasmic endometrial expression of Indian hedgehog is decreased in women with endometriosis.
21167467 the observed duplications lead to a misexpression and/or overexpression of IHH and by this affect the complex regulatory signaling network during digit and skull development.
20881264 The temporal increase in endometrial IHH during the secretory phase, and their modulation by CDB-2914 suggests progestin role in endometrial differentiation and implantation.
20854074 down-regulation of indian hedgehog expression as a result of hypermethylation, may be an early event in colorectal carcinogenesis
20846217 Observational study of gene-disease association. (HuGE Navigator)
20839884 VLDL carries Ihh throughout the body in mammals
20724312 Meta-analysis of gene-disease association. (HuGE Navigator)
20683927 This data confirms genetic heterogeneity in Brachydactyly A1 (BDA1) and demonstrates that mutations upstream of IHH can result in BDA1.
20546612 Observational study of gene-disease association. (HuGE Navigator)
20400458 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20007344 Indian hedgehog protein was detected in cystic tubules within human dysplastic kidneys; these molecules modify severity of this congenital malformation. Hedgehog signaling may be important stimulus for renal cyst formation.
19856079 Methylation analysis revealed that IHH promoter was hypermethylated in colon cancer cell lines.
19464397 BDA1 caused by a heterozygous mutation in the IHH gene on chromosome 5 was investigated in a large Swedish family.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19445942 An association of paracrine Hedgehog signaling with several gastrointestinal patterning events involving serosa, pylorus, and villus smooth muscle is shown.
19277064 Data show that all of the BDA1 mutations occur in a restricted area of the N-terminal active fragment of the IHH.
19213939 Ihh (Indian hedgehog homolog) signals via the BMP(bone morphogenetic protein) pathway, and specifically through BMP4, to promote endothelial cell differentiation from pluripotent cells
19074837 Hh signaling is important in the pathogenesis of B-CLL and, hence, may be a potential therapeutic target
18829534 A novel role of Runx2 in up-regulating the vicious cycle of metastatic bone disease, in addition to Runx2 regulation of genes related to progression of tumor metastasis.
18788453 its signal transduction regulates tumor development. (review)
18629882 A single smino acid deletion in IHH causes mild brachdactyly A1.
18391952 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17962696 enhanced signaling by Ihh can modulate the proliferation and differentiation of splenic B lymphocytes and thymic T lymphocytes during bone marrow hematopoiesis in vivo
17486609 D100N mutation must have arisen independently in these families, suggesting that 298G may be a mutational hot spot.
17387386 Ihh was expressed in 100% of conventional and clear cell chondrosarcomas, especially in matrix-rich areas. Mesenchymal chondrosarcomas revealed only focal expression of Ihh in matrix-rich areas.Ihh was absent or focally expressed in enchondromas.
17360475 the subset of MM cells that manifests Hh pathway activity is markedly concentrated within the tumor stem cell compartment
16871364 DNA sequence analysis revealed a heterozygous C to T transition at nucleotide 461 of IHH, resulting in a novel T154I substitution. The T154I mutation co-segregated with all affected individuals in the family.
16322088 Hedgehog signaling is conserved in hepatic progenitors from fetal development through adulthood and may be a new therapeutic target in patients with liver damage.
15146555 aberrant activation of the Ihh signaling pathway contributes to tumor development in pancreatic cancer
15105288 Ihh gene transfer into hTERT stromal cells enhanced their hematopoietic supporting potential in coculture with CD34+ cells
14770182 We report that Indian hedgehog (Ihh) is expressed by mature colonocytes and regulates their differentiation in vitro and in vivo.
14651602 Observational study of gene-disease association. (HuGE Navigator)
14651602 IHH is involved in the development of enteric nervous system but is not a major gene in Hirschsprung's disease.
14520411 a wide range of digestive tract tumours, including most of those originating in the oesophagus, stomach, biliary tract and pancreas, but not in the colon, display increased Hh pathway activity, which is suppressible by cyclopamine, a Hh pathway antagonist
12917489 model of the interactions between beta-catenin and hedgehog signaling in the epidermis in which SHH promotes proliferation of progenitors of the hair lineages whereas IHH stimulates proliferation of sebocyte precursors
12632327 Homozygous mutations in this gene cause acrocapitofemoral dysplasia, an autosomal recessive disorder with cone-shaped epiphyses in hands and hips.
12525541 A novel missense mutation in the IHH gene mapping to chromosome 5 has been identified identified in all patients of a brachydactyly type A1 family.
12384778 novel mutation causes brachydactyly type A1
12368206 expression is preserved in the growth plate of human fetuses affected with fibroblast growth factor receptor type 3 activating mutations
11476578 Mouse study of this member of Hedgehog family of signaling molecules in embryonic patterning and morphogenesis. Detection in target tissues requires proteoglycan/glycosaminoglycan.
7720571 describes cloning of human IHH

AA Sequence

MSPARLRPRLHFCLVLLLLLVVPAAWGCGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGK      1 - 70
IARSSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHS     71 - 140
EESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYYESKAHVHCSVKSEHSAAAKTGGCFPAGAQV    141 - 210
RLESGARVALSAVRPGDRVLAMGEDGSPTFSDVLIFLDREPHRLRAFQVIETQDPPRRLALTPAHLLFTA    211 - 280
DNHTEPAARFRATFASHVQPGQYVLVAGVPGLQPARVAAVSTHVALGAYAPLTKHGTLVVEDVVASCFAA    281 - 350
VADHHLAQLAFWPLRLFHSLAWGSWTPGEGVHWYPQLLYRLGRLLLEEGSFHPLGMSGAGS             351 - 411
//

Text Mined References (89)

PMID Year Title
26963384 2016 The Annexin a2 Promotes Development in Arthritis through Neovascularization by Amplification Hedgehog Pathway.
26705100 2015 Hedgehog signalling does not stimulate cartilage catabolism and is inhibited by Interleukin-1?.
26691363 2015 Correlation Between Hedgehog (Hh) Protein Family and Brain-Derived Neurotrophic Factor (BDNF) in Autism Spectrum Disorder (ASD).
26201092 2015 The Hedgehog signalling pathway mediates drug response of MCF-7 mammosphere cells in breast cancer patients.
25958162 2015 Indian hedgehog contributes to human cartilage endplate degeneration.
25888497 2015 Hedgehog signaling through GLI1 and GLI2 is required for epithelial-mesenchymal transition in human trophoblasts.
25692887 2015 Identification of the fourth duplication of upstream IHH regulatory elements, in a family with craniosynostosis Philadelphia type, helps to define the phenotypic characterization of these regulatory elements.
25519748 2015 Endogenously produced Indian Hedgehog regulates TGF?-driven chondrogenesis of human bone marrow stromal/stem cells.
24991722 2015 New insight into hedgehog signaling in hematological malignancies.
24844414 2014 Indian Hedgehog, a critical modulator in osteoarthritis, could be a potential therapeutic target for attenuating cartilage degeneration disease.
24786088 2014 Indian hedgehog in synovial fluid is a novel marker for early cartilage lesions in human knee joint.
24344235 2014 Novel neutralizing hedgehog antibody MEDI-5304 exhibits antitumor activity by inhibiting paracrine hedgehog signaling.
23883825 2013 Indian hedgehog signaling promotes chondrocyte differentiation in enchondral ossification in human cervical ossification of the posterior longitudinal ligament.
23786654 2013 Hedgehog signaling regulates hypoxia induced epithelial to mesenchymal transition and invasion in pancreatic cancer cells via a ligand-independent manner.
23575478 2013 Phase I study of the Hedgehog pathway inhibitor IPI-926 in adult patients with solid tumors.
23468532 2013 Combining hedgehog signaling inhibition with focal irradiation on reduction of pancreatic cancer metastasis.
23418531 2013 PBOV1 is a human de novo gene with tumor-specific expression that is associated with a positive clinical outcome of cancer.
23403897 2013 Hh signaling inhibitors from Vitex negundo; naturally occurring inhibitors of the GLI1-DNA complex.
23303278 2013 Hedgehog signaling pathway in ovarian cancer.
22817660 2012 Indian hedgehog gene transfer is a chondrogenic inducer of human mesenchymal stem cells.
22750747 2012 Intra-articular injection of human mesenchymal stem cells (MSCs) promote rat meniscal regeneration by being activated to express Indian hedgehog that enhances expression of type II collagen.
22507129 2012 Indian Hedgehog signalling triggers Nkx3.2 protein degradation during chondrocyte maturation.
22486854 2012 Hedgehog inhibitor decreases chemosensitivity to 5-fluorouracil and gemcitabine under hypoxic conditions in pancreatic cancer.
22469853 2012 Activation of Indian hedgehog promotes chondrocyte hypertrophy and upregulation of MMP-13 in human osteoarthritic cartilage.
22406540 2012 Prenatal diagnosis of a family affected by brachydactyly type A1 with a mutation in IHH: a useful lesson.
22234151 2012 A large duplication involving the IHH locus mimics acrocallosal syndrome.
22123293 2012 Developmental pathways in breast cancer and breast tumor-initiating cells: therapeutic implications.
21642379 2011 The skeleton: a multi-functional complex organ: the growth plate chondrocyte and endochondral ossification.
21640343 2011 Endometrial Indian hedgehog expression is decreased in women with endometriosis.
21537345 2011 Indian hedgehog mutations causing brachydactyly type A1 impair Hedgehog signal transduction at multiple levels.
21167467 2011 Copy-number variations involving the IHH locus are associated with syndactyly and craniosynostosis.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20881264 2010 Indian Hedgehog and its targets in human endometrium: menstrual cycle expression and response to CDB-2914.
20854074 2010 Opposite expression patterns of Sonic hedgehog and Indian hedgehog are associated with aberrant methylation status of their promoters in colorectal cancers.
20846217 2010 Association of linear growth impairment in pediatric Crohn's disease and a known height locus: a pilot study.
20839884 2010 Human plasma very low density lipoprotein carries Indian hedgehog.
20724312 2011 Meta-analyses of genes modulating intracellular T3 bio-availability reveal a possible role for the DIO3 gene in osteoarthritis susceptibility.
20683927 2010 Mutations in GDF5 presenting as semidominant brachydactyly A1.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
20519495 2010 All mammalian Hedgehog proteins interact with cell adhesion molecule, down-regulated by oncogenes (CDO) and brother of CDO (BOC) in a conserved manner.
20400458 2010 Genome-wide association of anthropometric traits in African- and African-derived populations.
20189936 2010 A genome-wide association study in 19 633 Japanese subjects identified LHX3-QSOX2 and IGF1 as adult height loci.
20007344 2010 Corticosteroid-induced kidney dysmorphogenesis is associated with deregulated expression of known cystogenic molecules, as well as Indian hedgehog.
19856079 2010 Distinct expression patterns of hedgehog ligands between cultured and primary colorectal cancers are associated with aberrant methylation of their promoters.
19464397 Brachydactyly type A1 associated with unusual radiological findings and a novel Arg158Cys mutation in the Indian hedgehog (IHH) gene.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19445942 2009 Paracrine Hedgehog signaling in stomach and intestine: new roles for hedgehog in gastrointestinal patterning.
19277064 2009 Brachydactyly A-1 mutations restricted to the central region of the N-terminal active fragment of Indian Hedgehog.
19213939 2009 Signaling hierarchy regulating human endothelial cell development.
19074837 2008 Hedgehog-induced survival of B-cell chronic lymphocytic leukemia cells in a stromal cell microenvironment: a potential new therapeutic target.
18829534 2008 Runx2 transcriptional activation of Indian Hedgehog and a downstream bone metastatic pathway in breast cancer cells.
18788453 2008 [Hedgehog signaling pathway and its impact on development of cancer therapy].
18698484 2008 Hedgehog signaling, epithelial-to-mesenchymal transition and miRNA (review).
18629882 2008 Deletion of 1 amino acid in Indian hedgehog leads to brachydactylyA1.
18391952 2008 Genome-wide association analysis identifies 20 loci that influence adult height.
18391951 2008 Many sequence variants affecting diversity of adult human height.
17962696 2008 Adenoviral vector-mediated transfer of the Indian hedgehog gene modulates lymphomyelopoiesis in vivo.
17889828 2007 IHH and FGF8 coregulate elongation of digit primordia.
17486609 2007 Recurrence of the D100N mutation in a Chinese family with brachydactyly type A1: evidence for a mutational hot spot in the Indian hedgehog gene.
17387386 2007 Differential expression of runx2 and Indian hedgehog in cartilaginous tumors.
17360475 2007 Hedgehog signaling maintains a tumor stem cell compartment in multiple myeloma.
16871364 2006 A novel heterozygous mutation in the Indian hedgehog gene (IHH) is associated with brachydactyly type A1 in a Chinese family.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16322088 2006 Hedgehog signaling maintains resident hepatic progenitors throughout life.
15839736 2005 Differentiation of insulin-producing cells from human neural progenitor cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146555 2004 Indian hedgehog signaling pathway: expression and regulation in pancreatic cancer.
15105288 2004 Indian hedgehog gene transfer augments hematopoietic support of human stromal cells including NOD/SCID-beta2m-/- repopulating cells.
14770182 2004 Indian Hedgehog is an antagonist of Wnt signaling in colonic epithelial cell differentiation.
14651602 2003 Is there a role for the IHH gene in Hirschsprung's disease?
14520411 2003 Widespread requirement for Hedgehog ligand stimulation in growth of digestive tract tumours.
12917489 2003 Indian hedgehog and beta-catenin signaling: role in the sebaceous lineage of normal and neoplastic mammalian epidermis.
12632327 2003 Homozygous mutations in IHH cause acrocapitofemoral dysplasia, an autosomal recessive disorder with cone-shaped epiphyses in hands and hips.
12525541 2003 Identification of a mutation in the Indian Hedgehog (IHH) gene causing brachydactyly type A1 and evidence for a third locus.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12384778 2002 A novel mutation in the IHH gene causes brachydactyly type A1: a 95-year-old mystery resolved.
12368206 2002 Parathyroid hormone receptor type 1/Indian hedgehog expression is preserved in the growth plate of human fetuses affected with fibroblast growth factor receptor type 3 activating mutations.
12176676 2002 Expression and localization of Indian hedgehog (Ihh) and parathyroid hormone related protein (PTHrP) in the human growth plate during pubertal development.
11476578 2001 The whereabouts of a morphogen: direct evidence for short- and graded long-range activity of hedgehog signaling peptides.
11455389 2001 Mutations in IHH, encoding Indian hedgehog, cause brachydactyly type A-1.
11435703 2001 The human hedgehog-interacting protein gene: structure and chromosome mapping to 4q31.21-->q31.3.
10462495 1999 Hedgehog signaling molecules in bone marrow cells at the initial stage of fracture repair.
10050855 1999 Vertebrate Hedgehog signalling modulated by induction of a Hedgehog-binding protein.
9811851 1998 Characterization of two patched receptors for the vertebrate hedgehog protein family.
9593755 1998 Identification of a palmitic acid-modified form of human Sonic hedgehog.
9186520 1997 Assignment of Indian hedgehog (IHH) to human chromosome bands 2q33-->q35 by in situ hybridization.
8824192 1996 Cholesterol modification of hedgehog signaling proteins in animal development.
7720571 1994 Products, genetic linkage and limb patterning activity of a murine hedgehog gene.
7590746 1995 Cloning, expression, and chromosomal location of SHH and IHH: two human homologues of the Drosophila segment polarity gene hedgehog.