Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.20
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -2.200 1.1e-05
atypical teratoid / rhabdoid tumor -2.700 9.1e-07
ependymoma -2.600 5.1e-12
glioblastoma -1.600 8.8e-05
group 4 medulloblastoma 2.100 2.8e-06
invasive ductal carcinoma 1.400 1.3e-02
Pick disease -1.200 1.3e-02
pituitary cancer 2.100 1.9e-03
subependymal giant cell astrocytoma -2.869 4.4e-03

Gene RIF (2)

AA Sequence

MRTAPSLRRCVCLLLAAILDLARGYLTVNIEPLPPVVAGDAVTLKCNFKTDGRMREIVWYRVTDGGTIKQ      1 - 70
KIFTFDAMFSTNYSHMENYRKREDLVYQSTVRLPEVRISDNGPYECHVGIYDRATREKVVLASGNIFLNV     71 - 140
MAPPTSIEVVAADTPAPFSRYQAQNFTLVCIVSGGKPAPMVYFKRDGEPIDAVPLSEPPAASSGPLQDSR    141 - 210
PFRSLLHRDLDDTKMQKSLSLLDAENRGGRPYTERPSRGLTPDPNILLQPTTENIPETVVSREFPRWVHS    211 - 280
AEPTYFLRHSRTPSSDGTVEVRALLTWTLNPQIDNEALFSCEVKHPALSMPMQAEVTLVAPKGPKIVMTP    281 - 350
SRARVGDTVRILVHGFQNEVFPEPMFTWTRVGSRLLDGSAEFDGKELVLERVPAELNGSMYRCTAQNPLG    351 - 420
STDTHTRLIVFENPNIPRGTEDSNGSIGPTGARLTLVLALTVILELT                           421 - 467
//

Text Mined References (10)

PMID Year Title