Property Summary

NCBI Gene PubMed Count 13
PubMed Score 8.82
PubTator Score 4.38

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
group 4 medulloblastoma -3.100 2.6e-06
adrenocortical carcinoma -2.394 2.1e-04
atypical teratoid/rhabdoid tumor -1.900 1.1e-02
pilocytic astrocytoma -1.100 5.9e-03
Endometriosis -1.742 1.2e-02
ovarian cancer -1.500 2.9e-07

Gene RIF (4)

PMID Text
26595655 Concerted role for IgSF11 and PSD-95 in the regulation of AMPAR-mediated synaptic transmission and plasticity.
16108831 IGSF11 is a good candidate of cancer-testis antigen. Furthermore, suppression of IGSF11 by siRNA retarded the growth of gastric cancer cells.
15795899 cell adhesion-inducing function of BT-IgSF suggests a role of the cell surface molecule in the development/function of the central nervous system and spermatogenesis
12207903 Molecular cloning of BT-IgSF which is preferentially expressed by brain and testis

AA Sequence

MTSQRSPLAPLLLLSLHGVAASLEVSESPGSIQVARGQPAVLPCTFTTSAALINLNVIWMVTPLSNANQP      1 - 70
EQVILYQGGQMFDGAPRFHGRVGFTGTMPATNVSIFINNTQLSDTGTYQCLVNNLPDIGGRNIGVTGLTV     71 - 140
LVPPSAPHCQIQGSQDIGSDVILLCSSEEGIPRPTYLWEKLDNTLKLPPTATQDQVQGTVTIRNISALSS    141 - 210
GLYQCVASNAIGTSTCLLDLQVISPQPRNIGLIAGAIGTGAVIIIFCIALILGAFFYWRSKNKEEEEEEI    211 - 280
PNEIREDDLPPKCSSAKAFHTEISSSDNNTLTSSNAYNSRYWSNNPKVHRNTESVSHFSDLGQSFSFHSG    281 - 350
NANIPSIYANGTHLVPGQHKTLVVTANRGSSPQVMSRSNGSVSRKPRPPHTHSYTISHATLERIGAVPVM    351 - 420
VPAQSRAGSLV                                                               421 - 431
//

Text Mined References (16)

PMID Year Title
26595655 2016 Synaptic adhesion molecule IgSF11 regulates synaptic transmission and plasticity.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
24023788 2013 Gene network analysis in a pediatric cohort identifies novel lung function genes.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22952603 2012 Genome-wide association study of d-amphetamine response in healthy volunteers identifies putative associations, including cadherin 13 (CDH13).
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16108831 2005 Identification of immunoglobulin superfamily 11 (IGSF11) as a novel target for cancer immunotherapy of gastrointestinal and hepatocellular carcinomas.
15795899 2005 BT-IgSF, a novel immunoglobulin superfamily protein, functions as a cell adhesion molecule.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12851705 2003 IGSF11 gene, frequently up-regulated in intestinal-type gastric cancer, encodes adhesion molecule homologous to CXADR, FLJ22415 and ESAM.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12207903 2002 Molecular cloning of a novel immunoglobulin superfamily gene preferentially expressed by brain and testis.