Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.75
PubTator Score 0.92

Knowledge Summary


No data available


  Differential Expression (20)

Disease log2 FC p
astrocytic glioma -1.100 4.0e-02
oligodendroglioma -1.500 1.7e-02
osteosarcoma -1.785 3.6e-03
group 3 medulloblastoma -2.200 1.5e-03
non diabetic and post-ischemic heart fai... 1.400 1.1e-02
type II diabetes mellitus and post-ische... 1.600 1.2e-02
glioblastoma -1.100 1.4e-02
medulloblastoma, large-cell -2.100 1.3e-04
Atopic dermatitis -1.800 1.3e-04
adrenocortical carcinoma -1.953 2.4e-06
non-small cell lung carcinoma -2.600 8.1e-35
breast carcinoma -1.400 2.3e-06
fibroadenoma -1.300 1.5e-02
Breast cancer -2.400 2.9e-02
lung adenocarcinoma -2.600 4.6e-20
invasive ductal carcinoma -2.800 1.3e-04
lung carcinoma -4.000 3.1e-32
ductal carcinoma in situ -1.700 7.6e-04
chronic rhinosinusitis -1.612 8.2e-03
cystic fibrosis and chronic rhinosinusit... -1.507 2.0e-02

AA Sequence

VIQNPQTSDSGIYKCTAKNPLGSDYAATYIQVI                                        2591 - 2623

Text Mined References (5)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14962803 2004 CMF608-a novel mechanical strain-induced bone-specific protein expressed in early osteochondroprogenitor cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.