Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Multiple myeloma -2.868 4.0e-03
cutaneous lupus erythematosus 2.900 3.2e-02
psoriasis -1.100 3.8e-02
osteosarcoma -5.781 5.6e-15
chronic lymphosyte leukemia -1.600 6.2e-03
periodontitis 2.200 6.6e-27
tuberculosis 1.200 6.5e-03
non-small cell lung cancer 1.022 5.8e-03
lung cancer -1.500 3.7e-05
interstitial cystitis 3.300 5.2e-03
ulcerative colitis 3.400 1.8e-04
Chronic obstructive pulmonary disease -1.100 2.9e-02

AA Sequence

MAWIPLLLPLLTLCTGSEASYELTQPPSVSVSPGQTARITCSGDALPKQYAYWYQQKPGQAPVLVIYKDS      1 - 70
ERPSGIPERFSGSSSGTTVTLTISGVQAEDEADYYCQSADSS                                 71 - 112
//

Text Mined References (14)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22158414 2011 Molecular programming of B cell memory.
20176268 2010 Structure and function of immunoglobulins.
17576170 2007 Immunoglobulin somatic hypermutation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11955599 2002 Recognition of immunoglobulins by Fcgamma receptors.
11872955 2001 Nomenclature of the human immunoglobulin lambda (IGL) genes.
10591208 1999 The DNA sequence of human chromosome 22.
9074928 1997 One-megabase sequence analysis of the human immunoglobulin lambda gene locus.
8951372 1996 Sequence and evolution of the human germline V lambda repertoire.
1249422 1976 Activation of C1r by proteolytic cleavage.
814163 1976 Physicochemical and functional characterization of the C1r subunit of the first complement component.
418804 1978 Amino acid sequence of the variable region of the light (lambda) chain from human myeloma cryoimmunoglobulin IgG Hil.