Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MAWALLLLTLLTQGTGSWAQSALTQPASVSGSPGQSITISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIY      1 - 70
EVSNRPSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCSSYTSSSTLHS                         71 - 120
//

Text Mined References (17)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22158414 2011 Molecular programming of B cell memory.
20176268 2010 Structure and function of immunoglobulins.
17576170 2007 Immunoglobulin somatic hypermutation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11955599 2002 Recognition of immunoglobulins by Fcgamma receptors.
11872955 2001 Nomenclature of the human immunoglobulin lambda (IGL) genes.
10591208 1999 The DNA sequence of human chromosome 22.
9074928 1997 One-megabase sequence analysis of the human immunoglobulin lambda gene locus.
8951372 1996 Sequence and evolution of the human germline V lambda repertoire.
5087637 1971 [Structural rule of antibodies. Complete primary structure of a monoclonal immunoglobin L chain of the lambda type, subgroup II (Bence Jones protein VIL)].
4909564 1970 The amino acid sequence of a lambda type Bence-Jones protein. 3. The complete amino acid sequence and the location of the disulfide bridges.
3922791 1985 Amino acid sequence of an amyloidogenic Bence Jones protein in myeloma-associated systemic amyloidosis.
1249422 1976 Activation of C1r by proteolytic cleavage.
814163 1976 Physicochemical and functional characterization of the C1r subunit of the first complement component.
500108 1979 Primary structure of cryo Bence-Jones protein (Tog) from the urine of a patient with IgD myeloma.