Property Summary

NCBI Gene PubMed Count 2
PubMed Score 14.20
PubTator Score 9.88

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
posterior fossa group B ependymoma -1.600 1.1e-10
diabetes mellitus 1.400 2.7e-03
adult high grade glioma -1.400 1.7e-03
group 3 medulloblastoma -1.700 2.4e-04
psoriasis 1.200 8.2e-28

Synonym

Accession A6NGN9
Symbols

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Mouse OMA Inparanoid

Gene RIF (1)

PMID Text
24703753 The target antigen of patients with rapid-eye-movement parasomnia who produce antibodies (mainly IgG4) against IgLON5 is a neuronal cell adhesion molecule that suggests a tauopathy

AA Sequence

MPPPAPGARLRLLAAAALAGLAVISRGLLSQSLEFNSPADNYTVCEGDNATLSCFIDEHVTRVAWLNRSN      1 - 70
ILYAGNDRWTSDPRVRLLINTPEEFSILITEVGLGDEGLYTCSFQTRHQPYTTQVYLIVHVPARIVNISS     71 - 140
PVTVNEGGNVNLLCLAVGRPEPTVTWRQLRDGFTSEGEILEISDIQRGQAGEYECVTHNGVNSAPDSRRV    141 - 210
LVTVNYPPTITDVTSARTALGRAALLRCEAMAVPPADFQWYKDDRLLSSGTAEGLKVQTERTRSMLLFAN    211 - 280
VSARHYGNYTCRAANRLGASSASMRLLRPGSLENSAPRPPGLLALLSALGWLWWRM                  281 - 336
//

Text Mined References (2)

PMID Year Title
24703753 2014 A novel non-rapid-eye movement and rapid-eye-movement parasomnia with sleep breathing disorder associated with antibodies to IgLON5: a case series, characterisation of the antigen, and post-mortem study.
15057824 2004 The DNA sequence and biology of human chromosome 19.