Property Summary

NCBI Gene PubMed Count 11
PubMed Score 230.69

Knowledge Summary

Patent

No data available

TINX Plot

Expression

AA Sequence

MRPKTGQVGCETPEELGPGPRQRWPLLLLGLAMVAHGLLRPMVAPQSGDPDPGASVGSSRSSLRSLWGRL      1 - 70
LLQPSPQRADPRCWPRGFWSEPQSLCYVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISD     71 - 140
FYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAP    141 - 210
TECS                                                                      211 - 214
//

Text Mined References (12)

PMID Year Title