Property Summary

NCBI Gene PubMed Count 20
PubMed Score 228.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Lymphoma 57 4.251 2.1
Amebiasis 22 3.54 1.8
Leukemia 88 3.281 1.6

Protein-protein Interaction (6)

Gene RIF (1)

PMID Text
12077254 The IGL C lambda 3 amplification polymorphism has been analyzed and its sequence structure determined.

AA Sequence

GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPAKAGVETTTPSKQSNNKYAASS      1 - 70
YLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTECS                                       71 - 106
//

Text Mined References (20)

PMID Year Title
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12077254 2002 Unraveling of the polymorphic C lambda 2-C lambda 3 amplification and the Ke+Oz- polymorphism in the human Ig lambda locus.
11955599 2002 Recognition of immunoglobulins by Fcgamma receptors.
9074928 1997 One-megabase sequence analysis of the human immunoglobulin lambda gene locus.
8676895 Recombinant human Fab antibody fragments to HIV-1 Rev and Tat regulatory proteins: direct selection from a combinatorial phage display library.
7737190 1995 Characterization of the two unique human anti-flavin monoclonal immunoglobulins.
6404900 1983 Comparative studies on the structure of the light chains of human immunoglobulins. IV. Assignment of a subsubgroup.
6273747 1981 Clustered arrangement of immunoglobulin lambda constant region genes in man.
5549568 1971 [Structural rule of antibodies. Primary structure of a monoclonal immunoglobulin-L-chain of the lambda type, subgroup IV (Bence-Jones-protein Kern). V. The complete amino acid sequence and its genetic interpretation].
4909564 1970 The amino acid sequence of a lambda type Bence-Jones protein. 3. The complete amino acid sequence and the location of the disulfide bridges.
4883841 1968 Immunoglobulin lambda-chains. The complete amino acid sequence of a Bence-Jones protein.
4814727 1974 Amino acid sequence of the (lambda) light chain of a human myeloma immunoglobulin (IgG New).
4415202 1974 Primary structure of the Mcg lambda chain.
4215080 1974 The three-dimensional structure of the fab' fragment of a human myeloma immunoglobulin at 2.0-angstrom resolution.
3122211 1987 Human immunoglobulin C lambda 6 gene encodes the Kern+Oz-lambda chain and C lambda 4 and C lambda 5 are pseudogenes.
2515285 1989 Three-dimensional structure of a light chain dimer crystallized in water. Conformational flexibility of a molecule in two crystal forms.
2115572 1990 Structure and expression of the human immunoglobulin lambda genes.
1249422 1976 Activation of C1r by proteolytic cleavage.
814163 1976 Physicochemical and functional characterization of the C1r subunit of the first complement component.