Property Summary

NCBI Gene PubMed Count 23
PubMed Score 0.00

Knowledge Summary


No data available

Gene RIF (2)

AA Sequence

YLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS                                       71 - 106

Text Mined References (28)

PMID Year Title