Property Summary

NCBI Gene PubMed Count 47
PubMed Score 0.00
PubTator Score 4.00

Knowledge Summary


No data available

PDB (77)

Gene RIF (16)

AA Sequence

TLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC                                      71 - 107

Text Mined References (56)

PMID Year Title