Property Summary

NCBI Gene PubMed Count 47
PubMed Score 0.00
PubTator Score 4.00

Knowledge Summary

Patent

No data available

TINX Plot

Synonym

Accession P01834
Symbols Km
HCAK1
IGKCD

Gene

PDB

3BN9   3BE1   3EYQ   3BDY   3DVG   3DVN   4D3C   3IU3   3B2U   3B2V   3C09   1A4J   1A4K   1CLY   1D5B   1D5I   1D6V   1DFB   1GAF   1HEZ   1HKL   1HZH   1I7Z   1MIM   1N0X   1OM3   1OP3   1OP5   1UCB   2NY7   2O5X   2O5Y   2O5Z   2QQK   2QQL   2QQN   2QSC   2R56   2RFX   2VXQ   3BKY   3BQU   3C08   3CFJ   3CFK   3CSY   3D0L   3D85   3EYF   3EYO   3O11   3QCT   3QCU   3QCV   3RU8   3U0W   3U7W   3U7Y   3VH8   3WUW   3X11   3X12   4D9R   4HIX   4NM4   4NM8   4XMP   4XNY   4XNZ   4XXD   4YDV   5B38   5B39   5ESV   5ESZ  

Gene RIF (16)

PMID Text
24304136 Data indicate the involvement of immunoglobulin allotypes immunoglobulin gamma and kappa chains in immunity to a cancer-testis antigen, which has important implications for XAGE-1b-based immunotherapeutic interventions in lung adenocarcinoma.
24054945 genetic polymorphism is associated with immunobiology of breast cancer in Japan
23370224 IGKC gene and protein expression in human non-small cell lung cancer is associated with prognosis.IGKC is expressed in stroma-infiltrating plasma cells.
23303672 A humanized rat strain carries a chimeric human/rat IgH locus together with fully human IgL loci (variable kappas linked to Jkappa-Ckappa and Vlambdas linked to Jlambda-Clambda).
23028600 Expression of IGKC has an independent protective impact on DFS and OS in node-negative breast cancer
22351685 The findings provide IGKC as a novel diagnostic marker for risk stratification in human cancer.
21701535 Light chain proximal tubulopathy without crystal formation, despite being rarely described in the literature, is over three times more common than light chain proximal tubulopathy with crystal formation in our series.
21646814 In survivors of chronic kidney failure, median serum levels of free kappa plus lambda immunoglobulin light chains are significantly higher compared with nonsurvivors.
20870723 Glycosaminoglycan sulfation enhanced the formation of immunoglobulin light chain amyloid oligomers and fibrils.
19317746 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18821675 Observational study of gene-disease association. (HuGE Navigator)
16083750 Differentially expressed Ig kappa-C gene only in abdominal aortic aneurysm(AAA) is candidate gene that may play pivotal role in pathogenesis of AAA formation.
12215905 Observational study of gene-disease association. (HuGE Navigator)
12039524 Observational study of gene-disease association. (HuGE Navigator)
12039524 TNF-alpha, IL1-beta, and immunoglobulin (GM and KM) gene polymorphisms in sarcoidosis.
11700059 aggregation of pathogenic Ig light chains

AA Sequence

TVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSST      1 - 70
LTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC                                       71 - 106
//

Text Mined References (51)

PMID Year Title
25946035 2015 Human Basal Tear Peptidome Characterization by CID, HCD, and ETD Followed by in Silico and in Vitro Analyses for Antimicrobial Peptide Identification.
24304136 2014 Genetic variants of immunoglobulin ? and ? chains influence humoral immunity to the cancer-testis antigen XAGE-1b (GAGED2a) in patients with non-small cell lung cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24054945 2014 IGKC and Fc?R genotypes and humoral immunity to HER2 in breast cancer.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23370224 2013 The prognostic relevance of tumour-infiltrating plasma cells and immunoglobulin kappa C indicates an important role of the humoral immune response in non-small cell lung cancer.
23303672 2013 High-affinity IgG antibodies develop naturally in Ig-knockout rats carrying germline human IgH/Ig?/Ig? loci bearing the rat CH region.
23028600 2012 Immunoglobulin kappa C predicts overall survival in node-negative breast cancer.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22351685 2012 A comprehensive analysis of human gene expression profiles identifies stromal immunoglobulin ? C as a compatible prognostic marker in human solid tumors.
21701535 2011 The morphologic spectrum and clinical significance of light chain proximal tubulopathy with and without crystal formation.
21646814 2011 Higher serum levels of free ? plus ? immunoglobulin light chains ameliorate survival of hemodialysis patients.
21269460 2011 Initial characterization of the human central proteome.
20870723 2010 Role of glycosaminoglycan sulfation in the formation of immunoglobulin light chain amyloid oligomers and fibrils.
19317746 2009 Single nucleotide polymorphism of interleukin-1beta associated with Helicobacter pylori infection in immune thrombocytopenic purpura.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
18821675 2008 Immunoglobulin gene polymorphisms are susceptibility factors in clinical and autoantibody subgroups of the idiopathic inflammatory myopathies.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16682481 2006 Production of an anti-severe acute respiratory syndrome (SARS) coronavirus human monoclonal antibody Fab fragment by using a combinatorial immunoglobulin gene library derived from patients who recovered from SARS.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16332457 Selection of a human anti-RhD monoclonal antibody for therapeutic use: impact of IgG glycosylation on activating and inhibitory Fc gamma R functions.
16083750 2005 Differential expression of immunoglobulin kappa chain constant region in human abdominal aortic aneurysm.
15174051 2004 An investigation into the human serum "interactome".
12736802 2003 Immunoglobulin KM genes in Guillain-Barré syndrome.
12552112 2003 Structural evidence for substrate strain in antibody catalysis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12215905 2002 Immunoglobulin kappa light chain gene alleles are not associated with primary Sjögren's syndrome.
12039524 2002 TNF-alpha, IL1-beta, and immunoglobulin (GM and KM) gene polymorphisms in sarcoidosis.
11955599 2002 Recognition of immunoglobulins by Fcgamma receptors.
11183784 2000 Catalysis of decarboxylation by a preorganized heterogeneous microenvironment: crystal structures of abzyme 21D8.
10354514 1999 Identification of a novel substitution in the constant region of a gene coding for an amyloidogenic kappa1 light chain.
9588180 1998 Extended analysis of AL-amyloid protein from abdominal wall subcutaneous fat biopsy: kappa IV immunoglobulin light chain.
8223863 1993 The V kappa genes of the L regions and the repertoire of V kappa gene sequences in the human germ line.
6779204 1980 Human immunoglobulin variable region genes--DNA sequences of two V kappa genes and a pseudogene.
6775818 1980 Cloned human and mouse kappa immunoglobulin constant and J region genes conserve homology in functional segments.
6402305 1983 Evolution of immunoglobulin V genes: evidence indicating that recently duplicated human V kappa sequences have diverged by gene conversion.
6308460 1983 A conserved sequence in the immunoglobulin J kappa-C kappa intron: possible enhancer element.
6276389 1982 Evolution of human immunoglobulin kappa J region genes.
6091049 1984 Immunoglobulin genes of the kappa light chain type from two human lymphoid cell lines are closely related.
5586923 1967 [The complete amino acid sequence of Bence Jones protein Cum (kappa-type)].
5489770 1970 The covalent structure of a human gamma G-immunoglobulin. VI. Amino acid sequence of the light chain.
5447531 1970 Macroglobulin structure: variable sequence of light and heavy chains.
5027703 1972 [Rule of antibody structure. The primary structure of a monoclonal immunoglobulin L-chain of kappa-type, subgroup 3 (Bence-Jones protein Ti). IV. The complete amino acid sequence and its significance for the mechanism of antibody production].
4923144 1970 The covalent structure of a human gamma G-immunoglobulin. X. Intrachain disulfide bonds.
4893682 1969 The amino acid sequence of a kappa type Bence-Jones protein. 3. The complete sequence and the location of the disulfide bridges.
3931219 1985 Molecular defects in a human immunoglobulin kappa chain deficiency.
1249422 1976 Activation of C1r by proteolytic cleavage.
814163 1976 Physicochemical and functional characterization of the C1r subunit of the first complement component.