Property Summary

NCBI Gene PubMed Count 47
PubMed Score 0.00
PubTator Score 4.00

Knowledge Summary

Patent

No data available

Gene RIF (16)

AA Sequence

RTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSS      1 - 70
TLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC                                      71 - 107
//

Text Mined References (56)

PMID Year Title