Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MEFGLSWVFLVALLRGVQCQVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVI      1 - 70
WYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR                            71 - 117
//

Text Mined References (11)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22158414 2011 Molecular programming of B cell memory.
20176268 2010 Structure and function of immunoglobulins.
17576170 2007 Immunoglobulin somatic hypermutation.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
11340299 2001 Nomenclature of the human immunoglobulin heavy (IGH) genes.
9841928 1998 The complete nucleotide sequence of the human immunoglobulin heavy chain variable region locus.
7441755 1980 Crystallographic refinement and atomic models of the intact immunoglobulin molecule Kol and its antigen-binding fragment at 3.0 A and 1.0 A resolution.
6884994 1983 [Three-dimensional structure determination of antibodies. Primary structure of crystallized monoclonal immunoglobulin IgG1 KOL, I].
1676037 1991 Molecular basis of an autoantibody-associated restriction fragment length polymorphism that confers susceptibility to autoimmune diseases.
420800 1979 Amino acid sequence of the VH region of human myeloma cryoimmunoglobulin IgG Hil.