Property Summary

NCBI Gene PubMed Count 19
PubMed Score 0.00
PubTator Score 0.83

Knowledge Summary

Patent

No data available

 GWAS Trait (1)

Gene RIF (4)

PMID Text
26232328 This study provides insights into the effector functions of human IgG3 in the context of an antibody targeting TfR1.
24619312 Logistic regression indicated that IgG3 detection was the only variable significantly related to the occurrence of RBC transfusion in autoimmune haemolytic anaemias
19542624 Immunoglobulin (Ig) GM genes - genetic markers of IgG heavy chains located on chromosome 14 - are functional risk and protective factors for AD.
17933503 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

ASTKGPSVFPLAPCSRSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT      1 - 70
VPSSSLGTQTYTCNVNHKPSNTKVDKRVELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPP     71 - 140
CPRCPEPKSCDTPPPCPRCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFKWYVD    141 - 210
GVEVHNAKTKPREEQYNSTFRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKTKGQPREPQVYT    211 - 280
LPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKLTVDKSRWQQG    281 - 350
NIFSCSVMHEALHNRFTQKSLSLSPGK                                               351 - 377
//

Text Mined References (24)

PMID Year Title
26232328 2015 Insights into the effector functions of human IgG3 in the context of an antibody targeting transferrin receptor 1.
24619312 2014 Haemoglobin levels in autoimmune haemolytic anaemias at diagnosis: relationship with immunoproteins on red blood cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23225573 2013 Genetic variants in the immunoglobulin heavy chain locus are associated with the IgG index in multiple sclerosis.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
19542624 2009 Immunoglobulin GM genes as functional risk and protective factors for the development of Alzheimer's disease.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
17933503 2008 Association between Gm allotypes and asthma severity from childhood to young middle age.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9126488 1997 Nucleotide sequences of all the gamma gene loci of murine immunoglobulin heavy chains.
8395549 1993 Rescue, expression, and analysis of a neutralizing human anti-hepatitis A virus monoclonal antibody.
6811139 1982 Structure of human immunoglobulin gamma genes: implications for evolution of a gene family.
6808505 1982 gamma Heavy chain disease in man: cDNA sequence supports partial gene deletion model.
6774747 1980 Primary structure of human gamma 3 immunoglobulin deletion mutant: gamma 3 heavy-chain disease protein Wis.
3141902 1988 Sigma region located between C mu and C delta genes of human immunoglobulin heavy chain: possible involvement of tRNA-like structure in RNA splicing.
3081877 1986 Sequence of a human immunoglobulin gamma 3 heavy chain constant region gene: comparison with the other human C gamma genes.
823945 1976 The amino acid sequence of "heavy chain disease" protein ZUC. Structure of the Fc fragment of immunoglobulin G3.
402363 1977 Primary structure of the "hinge" region of human IgG3. Probable quadruplication of a 15-amino acid residue basic unit.