Property Summary

Ligand Count 1
NCBI Gene PubMed Count 56
PubMed Score 0.00
PubTator Score 10.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count
Asthma 385
Chronic idiopathic urticaria 2
Disease Target Count P-value
psoriasis 6694 4.8e-12

PDB (20)

Gene RIF (46)

AA Sequence

ASTQSPSVFPLTRCCKNIPSNATSVTLGCLATGYFPEPVMVTWDTGSLNGTTMTLPATTLTLSGHYATIS      1 - 70
LLTVSGAWAKQMFTCRVAHTPSSTDWVDNKTFSVCSRDFTPPTVKILQSSCDGGGHFPPTIQLLCLVSGY     71 - 140
TPGTINITWLEDGQVMDVDLSTASTTQEGELASTQSELTLSQKHWLSDRTYTCQVTYQGHTFEDSTKKCA    141 - 210
DSNPRGVSAYLSRPSPFDLFIRKSPTITCLVVDLAPSKGTVNLTWSRASGKPVNHSTRKEEKQRNGTLTV    211 - 280
TSTLPVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNF    281 - 350
MPEDISVQWLHNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQR    351 - 420
AVSVNPGK                                                                  421 - 428
//

Text Mined References (61)

PMID Year Title