Property Summary

NCBI Gene PubMed Count 25
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
non-inflammatory breast cancer 208 1.6e-02

Expression

Gene RIF (1)

PMID Text
22894699 Using direct-tissue MALDI tandem mass spectrometry (MS/MS), we identified immunoglobulin heavy constant alpha 2 (IGHA2) as a new, zone-specific protein in the breast tumor microenvironment.

AA Sequence

ASPTSPKVFPLSLDSTPQDGNVVVACLVQGFFPQEPLSVTWSESGQNVTARNFPPSQDASGDLYTTSSQL      1 - 70
TLPATQCPDGKSVTCHVKHYTNPSQDVTVPCPVPPPPPCCHPRLSLHRPALEDLLLGSEANLTCTLTGLR     71 - 140
DASGATFTWTPSSGKSAVQGPPERDLCGCYSVSSVLPGCAQPWNHGETFTCTAAHPELKTPLTANITKSG    141 - 210
NTFRPEVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFA    211 - 280
VTSILRVAAEDWKKGDTFSCMVGHEALPLAFTQKTIDRMAGKPTHVNVSVVMAEVDGTCY              281 - 340
//

Text Mined References (28)

PMID Year Title
25645918 2015 Human neutrophils secrete bioactive paucimannosidic proteins from azurophilic granules into pathogen-infected sputum.
24145934 2013 Characterization, quantification, and assessment of immune protection potential of secretory immunoglobulin A in colostrum samples from Saudi women.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23398317 2013 Defective immunoglobulin A (IgA) glycosylation and IgA deposits in patients with IgA nephropathy.
23250751 2013 Human plasma-derived polymeric IgA and IgM antibodies associate with secretory component to yield biologically active secretory-like antibodies.
22894699 2012 In situ identification and localization of IGHA2 in the breast tumor microenvironment by mass spectrometry.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
18780401 2008 Identification of N-linked glycoproteins in human milk by hydrophilic interaction liquid chromatography and mass spectrometry.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17330941 2007 Enhanced analysis of the mouse plasma proteome using cysteine-containing tryptic glycopeptides.
16740002 2006 Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
15084671 2004 A proteomic analysis of human bile.
14760718 2004 Screening for N-glycosylated proteins by liquid chromatography mass spectrometry.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
6817141 1982 Arrangement of human immunoglobulin heavy chain constant region genes implies evolutionary duplication of a segment containing gamma, epsilon and alpha genes.
6804948 1982 Linkage and sequence homology of two human immunoglobulin gamma heavy chain constant region genes.
6421489 1984 Mechanisms of divergence and convergence of the human immunoglobulin alpha 1 and alpha 2 constant region gene sequences.
6407005 1983 Structure of the human immunoglobulin C epsilon 2 gene, a truncated pseudogene: implications for its evolutionary origin.
6327276 1982 Long terminal repeat-like elements flank a human immunoglobulin epsilon pseudogene that lacks introns.
6299662 1981 Nucleotide sequence of a human immunoglobulin C gamma 4 gene.
2241915 1990 The structure and function of human IgA.
416441 1978 Complete amino acid sequence of the alpha 2 heavy chain of a human IgA2 immunoglobulin of the A2m (2) allotype.
286295 1979 Structure of the A2m(1) allotype of human IgA--a recombinant molecule.