Property Summary

NCBI Gene PubMed Count 44
PubMed Score 0.00
PubTator Score 14.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6685 5.7e-04
non-inflammatory breast cancer 208 8.6e-03

Expression

  Differential Expression (2)

Disease log2 FC p
non-inflammatory breast cancer -2.900 8.6e-03
psoriasis -1.100 5.7e-04

Gene RIF (20)

PMID Text
26986150 In IgA nephropathy, increased APRIL is accompanied by elevated expression of its receptors in B-lymphocytes, which induces overproduction of galactose-deficient-IgA1.
26596049 The lower content of secretory immunoglobulin A and interferon-gamma plus increased level of interleukin l-beta in saliva of patients with caries of contact surfaces of lateral teeth can be considered as factor predisposing to development of caries.
25694468 Complement activation plays a key role in the pathogenesis and IGAN expression in patients diagnosed with IGA nephropathy.
25647400 hypermethylation of Cosmc promoter region could be a key mechanism for the reduction of Cosmc mRNA expression in IgAN lymphocytes with associated increase in aberrantly glycosylated IgA1
24928472 Serum under-O-glycosylated IgA1 levels are not correlated with glomerular IgA deposition based upon heterogeneity in the composition of glomerular immune complexes in IgAN patients.
24918438 The study developed a new model for sugar-specific sialylation of IgA1 O-glycans and showed that GalNAc recognition by Helix aspersa lectin is modulated by sialylation of not only GalNAc but also of Gal in the clustered IgA1 O-glycans.
24676358 The heritability of IgA levels is moderate and can partly be attributable to common variation in the CD30L locus.
24586974 The palatine tonsils are probably a major site of galactose-deficient IgA1-producing cells.
22864623 In breast cancer, elevated levels of antibodies recognizing aberrant MUC1 are associated with better outcome, whereas in IgA nephropathy, the antibodies recognizing aberrant IgA1 are part of the pathogenetic process. [review]
20007591 Observational study of gene-disease association. (HuGE Navigator)
19531670 Gal-deficient IgA1 might be inherited in Chinese patients with immunoglobulin A nephropathy
19153537 Various expression patterns of alpha1 and alpha2 genes in IgA deficiency.
18826328 Analysis of IgA1 N-glycosylation and its contribution to FcalphaRI binding are reported.
18538846 Alleles and isoforms of human membrane-bound IgA1.
18323783 There was an increased frequency of the (*)2 allele of HS1,2-A in dermatitis herpetiformis, plaque psoriatic, and psoriatic arthritis patients.
17511028 Immunoglobulin A1 is originally expressed and V(D)J recombination machine is also present in non-lymphoid cells, suggesting that V(D)J recombination machine mediates the assembly of immunoglobulin A1 in non-lymphoid cells as in pre-lymphocytes
16376934 Data describe the purification, properties and solution structure of the complex formed between human immunoglobulin A1 and human serum albumin.
15731049 susceptibility to cleavage by IgA1 proteases appears to depend on the precise sequence & hence the 3-D structure of the IgA hinge, the context of the cleavage site within the hinge & within the protein as a whole & the structure of the particular protein
12023968 role of constant region carbohydrate in the assembly and secretion of human IgA1.
10438530 Interaction site for human Fc alpha receptor CD89 lies at interface between CH2 and CH3 domains of Fc region of IgA

AA Sequence

ASPTSPKVFPLSLCSTQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTARNFPPSQDASGDLYTTSSQL      1 - 70
TLPATQCLAGKSVTCHVKHYTNPSQDVTVPCPVPSTPPTPSPSTPPTPSPSCCHPRLSLHRPALEDLLLG     71 - 140
SEANLTCTLTGLRDASGVTFTWTPSSGKSAVQGPPERDLCGCYSVSSVLPGCAEPWNHGKTFTCTAAYPE    141 - 210
SKTPLTATLSKSGNTFRPEVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWA    211 - 280
SRQEPSQGTTTFAVTSILRVAAEDWKKGDTFSCMVGHEALPLAFTQKTIDRLAGKPTHVNVSVVMAEVDG    281 - 350
TCY                                                                       351 - 353
//

Text Mined References (50)

PMID Year Title
26986150 2016 Increased APRIL Expression Induces IgA1 Aberrant Glycosylation in IgA Nephropathy.
26596049 2015 [THE IMMUNOLOGIC INDICATORS IN PATIENTS WITH CARIES OF CONTACT SURFACES OF LATERAL TEETH].
25694468 2015 Current Understanding of the Role of Complement in IgA Nephropathy.
25647400 2015 DNA methylation in Cosmc promoter region and aberrantly glycosylated IgA1 associated with pediatric IgA nephropathy.
24928472 2014 Serum under-O-glycosylated IgA1 level is not correlated with glomerular IgA deposition based upon heterogeneity in the composition of immune complexes in IgA nephropathy.
24918438 2014 Enzymatic sialylation of IgA1 O-glycans: implications for studies of IgA nephropathy.
24676358 2014 IgA measurements in over 12 000 Swedish twins reveal sex differential heritability and regulatory locus near CD30L.
24586974 2014 Changes in nephritogenic serum galactose-deficient IgA1 in IgA nephropathy following tonsillectomy and steroid therapy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24145934 2013 Characterization, quantification, and assessment of immune protection potential of secretory immunoglobulin A in colostrum samples from Saudi women.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23398317 2013 Defective immunoglobulin A (IgA) glycosylation and IgA deposits in patients with IgA nephropathy.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23250751 2013 Human plasma-derived polymeric IgA and IgM antibodies associate with secretory component to yield biologically active secretory-like antibodies.
22864623 2013 Aberrant O-glycosylation and anti-glycan antibodies in an autoimmune disease IgA nephropathy and breast adenocarcinoma.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22171320 2012 Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20007591 2009 Allele *1 of HS1.2 enhancer associates with selective IgA deficiency and IgM concentration.
19838169 2009 Enrichment of glycopeptides for glycan structure and attachment site identification.
19531670 2009 Aberrant galactosylation of IgA1 is involved in the genetic susceptibility of Chinese patients with IgA nephropathy.
19153537 2009 Various expression patterns of alpha1 and alpha2 genes in IgA deficiency.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
18826328 2008 Analysis of IgA1 N-glycosylation and its contribution to FcalphaRI binding.
18538846 2008 Alleles and isoforms of human membrane-bound IgA1.
18323783 2008 Increased frequency of Ig heavy-chain HS1,2-A enhancer *2 allele in dermatitis herpetiformis, plaque psoriasis, and psoriatic arthritis.
17511028 2007 Expression of SNC73, a transcript of the immunoglobulin alpha-1 gene, in human epithelial carcinomas.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16376934 2006 Purification, properties and extended solution structure of the complex formed between human immunoglobulin A1 and human serum albumin by scattering and ultracentrifugation.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
16293625 2006 A competitive mechanism for staphylococcal toxin SSL7 inhibiting the leukocyte IgA receptor, Fc alphaRI, is revealed by SSL7 binding at the C alpha2/C alpha3 interface of IgA.
15731049 2005 Effect of mutations in the human immunoglobulin A1 (IgA1) hinge on its susceptibility to cleavage by diverse bacterial IgA1 proteases.
15084671 2004 A proteomic analysis of human bile.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12023968 2002 The role of constant region carbohydrate in the assembly and secretion of human IgD and IgA1.
11290337 2001 IRTA1 and IRTA2, novel immunoglobulin superfamily receptors expressed in B cells and involved in chromosome 1q21 abnormalities in B cell malignancy.
11257305 2000 Human and murine immunoglobulin expression vector cassettes.
10438530 1999 Identification of residues in the CH2/CH3 domain interface of IgA essential for interaction with the human fcalpha receptor (FcalphaR) CD89.
7506257 1994 Location of a novel type of interpolypeptide chain linkage in the human protein HC-IgA complex (HC-IgA) and identification of a heterogeneous chromophore associated with the complex.
6811139 1982 Structure of human immunoglobulin gamma genes: implications for evolution of a gene family.
6421489 1984 Mechanisms of divergence and convergence of the human immunoglobulin alpha 1 and alpha 2 constant region gene sequences.
2241915 1990 The structure and function of human IgA.
809331 1975 [The primary structure of a monoclonal IgA-immunoglobulin (IgA Tro.), II. The amino acid sequence of the H-chain, alpha-type, subgroup III; structure of the complete IgA-molecule (author's transl)].
393607 1979 [Rule of antibody structure. Primary structure of a human monoclonal IgA-immunoglobulin (myeloma protein Tro). VII. Purification and characterization of the disulfide bridges].
107164 1979 Primary structure of a human IgA1 immunoglobulin. IV. Streptococcal IgA1 protease, digestion, Fab and Fc fragments, and the complete amino acid sequence of the alpha 1 heavy chain.