Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.50
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung carcinoma 2844 3.8e-29

Expression

  Differential Expression (1)

Disease log2 FC p
lung carcinoma 1.200 3.8e-29

AA Sequence

MVPRISAAIFIFELLGSNSEGVTDLRLWLCQPAPRCGEWTYNPLEQCCDDGVILDLNQTRLCGSSCTFWP      1 - 70
CFQHCCLESLGSQNQTVVRFKVPGMKPDCKSSPITRICAQEYHPKSPVSRSDLI                     71 - 124
//

Text Mined References (3)

PMID Year Title
16890402 2006 IGFL: A secreted family with conserved cysteine residues and similarities to the IGF superfamily.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.