Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.51
PubTator Score 0.16

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
Atopic dermatitis -2.200 1.7e-05
atypical teratoid / rhabdoid tumor 1.100 1.4e-03
lung adenocarcinoma 1.400 3.3e-04
non-small cell lung cancer 1.242 1.3e-09
pancreatic cancer 1.400 1.9e-04
psoriasis -1.600 4.4e-24

AA Sequence

MVPRIFAPAYVSVCLLLLCPREVIAPAGSEPWLCQPAPRCGDKIYNPLEQCCYNDAIVSLSETRQCGPPC      1 - 70
TFWPCFELCCLDSFGLTNDFVVKLKVQGVNSQCHSSPISSKCESRRRFP                          71 - 119
//

Text Mined References (6)

PMID Year Title