Property Summary

NCBI Gene PubMed Count 66
PubMed Score 118.38
PubTator Score 105.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
malignant mesothelioma -4.200 3.6e-09
ependymoma -1.600 2.0e-02
oligodendroglioma -1.500 1.4e-02
psoriasis -1.600 8.5e-05
medulloblastoma, large-cell -1.300 3.7e-03
adrenocortical adenoma -1.495 3.4e-02
adrenocortical carcinoma -3.083 7.1e-16
non-small cell lung cancer -1.158 1.6e-06
intraductal papillary-mucinous adenoma (... -2.200 2.5e-04
intraductal papillary-mucinous carcinoma... -2.800 2.5e-05
intraductal papillary-mucinous neoplasm ... -1.900 9.7e-03
colon cancer -1.100 7.1e-04
sarcoidosis -1.300 2.9e-02
breast carcinoma -2.400 7.4e-24
fibroadenoma -1.800 2.4e-03
cystic fibrosis 1.100 2.8e-03
lung adenocarcinoma -1.700 3.3e-06
invasive ductal carcinoma -3.900 1.8e-04
non-inflammatory breast cancer -2.100 2.2e-05
spina bifida -1.186 4.5e-02
ductal carcinoma in situ -2.700 8.3e-04
ovarian cancer -4.600 9.8e-16
pituitary cancer -3.100 3.0e-08
pancreatic cancer 1.500 4.4e-03

Gene RIF (44)

PMID Text
26039376 We found that IGFBP6 and SATB2 were significantly down-regulated in HIV-infected CEM*174 cells and 3 different cohorts of HIV/AIDS patients while their promoters were predominantly hyper-methylated compared with normal controls.
24747338 CCL-18 and IGFBP-6 were identified as new potential serum biomarkers for prostate cancer.
24379119 IGFBP6 attenuation in ACTH-secreting pituitary adenomas is associated with tumor growth, through activation of PI3K-AKT-mTOR pathway
24182837 Our results indicate that IGF2 and IGFBP6 appear to govern various regulatory feedback mechanisms in periodontal ligament cells
24003225 Data indicate that IGFBP-6 binds to prohibitin-2 on the cell membrane, and knockdown of the latter abrogates IGFBP-6-induced migration.
23808406 When the concentrations of IGFBP-6 or KNG1 were greater than 98.5 pg/ml or 88.5 ng/ml, respectively, they predicted the proliferative vitreoretinopathy prognosis.
23623986 This is the first report to implicate IGFBP-6 as a suppressor of cellular proliferation and IGF-II as an inducer of cellular contractility in this connective tissue disease.
23126425 Review of the IGF system in physiology and disease with a focus on the regulation and actions of IGFBP-6, and its potential roles in cancer cells.
21997736 IGFBP-6 acts as a inhibitory mediator of thyroid hormone effects in osteoblast differentiation
21940310 Hh pathway is aberrant activation in colorectal carcinoma cell line. Its inhibitor may be effectual agent for colorectal cancer chemoprevention. Gli1 maintained cell survival by binding promoter regions and facilitating transcription of IGFBP6 and Bcl-2.
21820463 When IGFBP-6 gene expression was downregulated, cell proliferation was inhibited and apoptotic cell death was increased.
21618524 These results suggest that the expression of IGFBP-6 in vascular endothelial cells is up-regulated by hypoxia and IGFBP-6 inhibits angiogenesis in vitro and in vivo
21548981 The authors conclude that during hepatitis B/C virus infection, O-beta-GlcNAc of IGFBP-6 at Ser 204 diminish their binding with IGF-II, increase IGF-II cellular expression and promote cancer progression.
21458526 IGFBP-6 inhibits osteoblastic differentiation mediated by vitamin d3 by directly binding the vitamin d receptor and inhibiting its function
21054968 Kininogen-1 and IGFBP-6 are expressed in serum and vitreous humor in proliferative vitreoretinopathy patients.
20810604 Observational study of gene-disease association. (HuGE Navigator)
20734064 Observational study of gene-disease association. (HuGE Navigator)
20634197 Meta-analysis of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20432455 These results indicate that IGFBP-6 promotes Rh30 rhabdomyosarcoma chemotaxis in an IGF-independent manner, and that MAPK signaling pathways and their cross-talk play an important role in this process.
19950226 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18985860 IGFBP-6 is the effector of tumor suppressor activity of SEMA3B.
18982452 Data show that an increase in JNK activation in the presence of NFkappaB inhibition significantly increased the expression of IGFBP6.
18957410 bexarotene increased the occupancy of the identified enhancer element in IGFBP-6 gene by RXRalpha, RARbeta, cJun, cFos, and p300
18724896 TCDD at low concentrations may have a negative effect on cell apoptosis and down-regulate gene expression of IGFBP-6 in SaOS-2 cells.
18676680 Observational study of gene-disease association. (HuGE Navigator)
18395833 These studies provide evidence that overexpression of IGFBP-6 suppresses human and murine osteoblast differentiation, that IGFBP-6 and LMP-1 physically interact, and supports the conclusion that this interaction may be functionally relevant.
18039785 IGFBP-6 is translocated to the nucleus with functional consequences, and different members of the IGFBP family have specific nuclear import mechanisms.
17978469 Toxic effect of TCDD on osteogenesis through altering IGFBP6 gene expression in osteoblasts is reported.
17519236 p38 MAPK is involved in IGFBP-6-induced IGF-independent rhabdomyosarcoma cell migration
15889232 transgenic human IGFBP-6 mice may be considered a new tool for studies of the involvement of the brain IGF system in metabolism control and obesity.
15797461 The IGFBP-6 protein is synthesized as propeptides with a hydrophobic leader sequence, removal of which yields a mature protein composed of 3 recognizable domains of similar size.
15661050 The expression of certain IGFBP is significantly altered in renal cell carcinoma
15366928 A close correlation exists between residues of the carboxyl-terminal domain of IGFBP6 undergoing conformational change in 15N NMR spectroscopy studies with those that disappeared or broadened upon insulin-like growth factor (IGF-II) binding.
15308688 C-domain of IGFBP-6 consists of a thyroglobulin type 1 fold comprising an alpha-helix followed by a loop, a three-stranded antiparallel beta-sheet incorporating a second loop, and a disulfide-bonded flexible third loop.
14710364 CCI-779 acts additively with IGFBP-6 to reduce rhabdomyosarcoma growth both in vitro and in vivo.
12558805 may function as an antiproliferative molecule suppressing mitogenic effects of insulin-like growth factors on Malassez cells
12006706 determination of blood levels in adult patients with severe liver disease before and after orthotopic liver transplantation
11914024 Inhibition of human osteoblast marker gene expression by retinoids is mediated in part by insulin-like growth factor binding protein-6.

AA Sequence

MTPHRLLPPLLLLLALLLAASPGGALARCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAEAEGCLRREGQE      1 - 70
CGVYTPNCAPGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKESKPQAGTARPQDVNRRDQQRN     71 - 140
PGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRG    141 - 210
PCWCVDRMGKSLPGSPDGNGSSSCPTGSSG                                            211 - 240
//

Text Mined References (67)

PMID Year Title
26039376 2015 Whole genome methylation array reveals the down-regulation of IGFBP6 and SATB2 by HIV-1.
24747338 2014 CC chemokine ligand 18 and IGF-binding protein 6 as potential serum biomarkers for prostate cancer.
24431302 2014 Wnt signaling in midbrain dopaminergic neuron development and regenerative medicine for Parkinson's disease.
24379119 2014 Downregulation of Insulin-like growth factor binding protein 6 is associated with ACTH-secreting pituitary adenoma growth.
24182837 2013 Autoregulation of insulin-like growth factor 2 and insulin-like growth factor-binding protein 6 in periodontal ligament cells in vitro.
24003225 2013 Prohibitin-2 binding modulates insulin-like growth factor-binding protein-6 (IGFBP-6)-induced rhabdomyosarcoma cell migration.
23808406 2014 Kininogen 1 and insulin-like growth factor binding protein 6: candidate serum biomarkers of proliferative vitreoretinopathy.
23623986 2013 IGF-II and IGFBP-6 regulate cellular contractility and proliferation in Dupuytren's disease.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23126425 2013 Insulin-like growth factor-binding protein-6 and cancer.
21997736 2012 Insulin-like growth factor binding protein-6 interacts with the thyroid hormone receptor ?1 and modulates the thyroid hormone-response in osteoblastic differentiation.
21940310 Cyclopamine blocked the growth of colorectal cancer SW116 cells by modulating some target genes of Gli1 in vitro.
21820463 2011 Insulin-like growth factor binding protein-6 delays replicative senescence of human fibroblasts.
21618524 2012 IGF binding protein-6 expression in vascular endothelial cells is induced by hypoxia and plays a negative role in tumor angiogenesis.
21548981 2011 Serine 204 phosphorylation and O-?-GlcNAC interplay of IGFBP-6 as therapeutic indicator to regulate IGF-II functions in viral mediated hepatocellular carcinoma.
21458526 2011 A novel interaction between insulin-like growth factor binding protein-6 and the vitamin D receptor inhibits the role of vitamin D3 in osteoblast differentiation.
21054968 2010 [Kininogen-1 and insulin-like growth factor binding protein-6 as serum biomarkers for proliferative vitreoretinopathy].
20810604 2010 Eighteen insulin-like growth factor pathway genes, circulating levels of IGF-I and its binding protein, and risk of prostate and breast cancer.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20634197 2010 Comprehensive analysis of common genetic variation in 61 genes related to steroid hormone and insulin-like growth factor-I metabolism and breast cancer risk in the NCI breast and prostate cancer cohort consortium.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20432455 2010 Cross-talk between MAP kinase pathways is involved in IGF-independent, IGFBP-6-induced Rh30 rhabdomyosarcoma cell migration.
19950226 2010 Single nucleotide polymorphisms in miRNA binding sites and miRNA genes as breast/ovarian cancer risk modifiers in Jewish high-risk women.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19838169 2009 Enrichment of glycopeptides for glycan structure and attachment site identification.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
18985860 2008 Identification of IGFBP-6 as an effector of the tumor suppressor activity of SEMA3B.
18982452 2008 Regulation of IGFBP6 gene and protein is mediated by the inverse expression and function of c-jun N-terminal kinase (JNK) and NFkappaB in a model of oral tumor cells.
18957410 2009 Rexinoid-induced expression of IGFBP-6 requires RARbeta-dependent permissive cooperation of retinoid receptors and AP-1.
18724896 2008 [Effect of dioxin on apoptosis of osteogenic sarcoma cells and regulation on gene expression of insulin-like growth factor binding protein 6].
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18395833 2008 Potential involvement of the interaction between insulin-like growth factor binding protein (IGFBP)-6 and LIM mineralization protein (LMP)-1 in regulating osteoblast differentiation.
18039785 2008 A functional nuclear localization signal in insulin-like growth factor binding protein-6 mediates its nuclear import.
17978469 2007 Toxic effects of TCDD on osteogenesis through altering IGFBP-6 gene expression in osteoblasts.
17519236 2007 Promotion of cancer cell migration: an insulin-like growth factor (IGF)-independent action of IGF-binding protein-6.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
15889232 2005 Dysregulation of energy homeostasis in mice overexpressing insulin-like growth factor-binding protein 6 in the brain.
15797461 2005 Insulin-like growth factor signaling in fish.
15661050 2005 Altered messenger RNA and protein expressions for insulin-like growth factor family members in clear cell and papillary renal cell carcinomas.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15366928 2004 C-terminal domain of insulin-like growth factor (IGF) binding protein 6: conformational exchange and its correlation with IGF-II binding.
15308688 2004 C-terminal domain of insulin-like growth factor (IGF) binding protein-6: structure and interaction with IGF-II.
14710364 Insulin-like growth factor binding protein-6 and CCI-779, an ester analogue of rapamycin, additively inhibit rhabdomyosarcoma growth.
12558805 2003 Immunohistochemical localization of insulin-like growth factor-II and its binding protein-6 in human epithelial cells of Malassez.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12006706 2002 Insulin-like growth factors and insulin-like growth factor binding proteins in adult patients with severe liver disease before and after orthotopic liver transplantation.
11297622 2001 Transferrin is an insulin-like growth factor-binding protein-3 binding protein.
11267670 2001 Structure and characterization of the human insulin-like growth factor binding protein (IGFBP)-6 promoter: identification of a functional retinoid response element.
10414596 1999 Insulin-like growth factors (IGF-I, free IGF-I and IGF-II) and insulin-like growth factor binding proteins (IGFBP-2, IGFBP-3, IGFBP-6, and ALS) in blood circulation.
10329650 1999 The N-terminal disulfide linkages of human insulin-like growth factor-binding protein-6 (hIGFBP-6) and hIGFBP-1 are different as determined by mass spectrometry.
10087296 1999 Characterization and chromosomal localization of the human insulin-like growth factor-binding protein 6 gene.
9572875 1998 Identification of O-glycosylation sites and partial characterization of carbohydrate structure and disulfide linkages of human insulin-like growth factor binding protein 6.
7692907 1993 Molecular cloning of IGFBP-5 from SCLC cell lines and expression of IGFBP-4, IGFBP-5 and IGFBP-6 in lung cancer cell lines and primary tumours.
7683646 1993 Binding of mutants of human insulin-like growth factor II to insulin-like growth factor binding proteins 1-6.
7683540 1993 Insulin-like growth factor binding protein-4, -5 and -6 mRNAs in the human fetus: localization to sites of growth and differentiation?
7539002 1995 A human keratinocyte cell line produces two autocrine growth inhibitors, transforming growth factor-beta and insulin-like growth factor binding protein-6, in a calcium- and cell density-dependent manner.
7511544 1993 Insulin-like growth factor binding proteins in the human adrenal gland.
2551732 1989 Isolation from human cerebrospinal fluid of a new insulin-like growth factor-binding protein with a selective affinity for IGF-II.
2154495 1990 Purification and properties of a novel insulin-like growth factor-II binding protein from transformed human fibroblasts.
1850258 1991 Molecular cloning of a new human insulin-like growth factor binding protein.
1850257 1991 A novel human insulin-like growth factor binding protein secreted by osteoblast-like cells.
1719383 1991 Isolation and molecular cloning of insulin-like growth factor-binding protein-6.
1709161 1991 Identification and molecular cloning of two new 30-kDa insulin-like growth factor binding proteins isolated from adult human serum.
1697583 1990 Isolation from adult human serum of four insulin-like growth factor (IGF) binding proteins and molecular cloning of one of them that is increased by IGF I administration and in extrapancreatic tumor hypoglycemia.