Property Summary

NCBI Gene PubMed Count 142
PubMed Score 346.58
PubTator Score 241.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 2.0
Disease Target Count Z-score Confidence
Cancer 2346 3.905 2.0

Expression

  Differential Expression (35)

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (106)

PMID Text
26103640 data provide further insights into the role of cellular compartmentalization in IGFBP-5-induced fibrosis
26010068 Results shed light on the mechanism of IGFBP5 as a potential tumor-suppressor in melanoma progression.
25827480 Demethylation of IGFBP5 by Histone Demethylase KDM6B Promotes Mesenchymal Stem Cell-Mediated Periodontal Tissue Regeneration by Enhancing Osteogenic Differentiation and Anti-Inflammation Potentials.
25603050 miR-204-5p suppresses IGFBP5 expression by direct binding to the 3' untranslated region.
25548030 Our results suggest that rs6214 on the IGF1 gene and rs2854744 near the IGFBP3 gene potentially play an important role with ASMI in Taiwanese older adults in a metropolitan area.
25475528 Data indicate co-localization of insulin-like growth factor binding proteins IGFBP-4, IGFBP-5 in the syncytiotrophoblast layer of first trimester placental villi as early as 5 weeks of gestational age.
25422220 IGFBP5 mRNA expression is a good indicator in clinical outcome of breast cancer patients.
25248036 rs4442975 at 2q35 flanks a transcriptional enhancer that physically interacts with the promoter of IGFBP5. Evidence suggests that the g-allele confers increased breast cancer susceptibility through relative downregulation of IGFBP5.
25007054 IGFBP-5 may be a negative modulator of RASSF1C/ PIWIL1 growth-promoting activities.
24551065 IGFBP-5 induces its pro-fibrotic effects, at least in part, via DOK5. IGFBP-5 and DOK5 are both increased in systemic sclerosis fibroblasts and tissues and may thus be acting in concert to promote fibrosis.
24379630 Serum IGFBP-5 concentrations were lower in Crohn's disease patients compared to healthy controls regardless of disease activity or the presence of stricture formation.
24120850 IGFBP-5 is important in maintaining epithelial-mesenchymal boundaries and thus may limit metastasis and fibrosis by inducing an orderly repair mechanism, very distinct from the fibrotic disruption induced by TGFbeta1.
23665505 IGFBP5 domains modulate tumorigenicity and metastasis of human osteosarcoma in different ways
23576565 Data suggest that insulin-like growth factor-binding protein 5 (IGFBP5) regulation by calcium-dependent chloride channel DOG1.
23539739 IGFBP-5 overexpression is a poor prognostic factor in patients with urothelial carcinomas of upper urinary tracts and urinary bladder.
23499909 IGFBP-5 modulates the efficiency of estrogen-triggered activation of the Akt/PKB signaling pathway which has been associated with growth factor/ ERalpha cross-talks.
22571677 VEGF may play a regulator role in human ovarian physiology by modulating the expression of IGF-II and IGFBP-5 in luteinized granulosa cells.
22328518 The IGFBP5 enhanced adhesion, it inhibited cell migration, although this was not evident using the truncated C-terminal mutant, suggesting that effects of IGFBP5 on adhesion and migration involve different mechanisms.
22252554 c-Src and IL-6 inhibit osteoblast differentiation and integrate IGFBP5 signalling
22246875 This study demonistrated that IGFBP5 was significantly decreased in skeletal muscel in patient with amyotrophic lateral sclerosis.
21852217 We genotyped single-nucleotide polymorphisms of IGF1, IGF2, IGF1R, IGF2R, IGFBP1, IGFBP3, IGFBP5, IRS1, IRS2, and IRS in pancreatic cancer patients
21460855 Insulin-like growth factor binding protein 5 is a novel marker that has an important role in the pathogenesis of osteosarcoma. The loss of insulin-like growth factor binding protein 5 function may contribute to metastasis in osteosarcoma.
21256825 the L-domain of IGFBP-5 is a novel TNFR1 ligand that functions as a competitive TNF-alpha inhibitor.
21191810 results suggest that PGE(2) may play an important role in controlling cellular senescence of HDFs through the regulation of IGFBP5 and therefore may contribute to inflammatory disorders associated with aging
21029365 Data revealed a strong induction of several genes encoding components of the extracellular matrix, such as collagens, COMP, IGFBP5 and biglycan.
20949447 The IGFBP5 polymorphism is functional and may potentially be a biomarker for susceptibility to late-stage risk of squamous cell carcinoma of the head and neck.
20949447 Observational study of gene-disease association. (HuGE Navigator)
20944648 IGFBP-5 has an effect on human hair shape.
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20810604 Observational study of gene-disease association. (HuGE Navigator)
20734064 Observational study of gene-disease association. (HuGE Navigator)
20634197 Meta-analysis of gene-disease association. (HuGE Navigator)
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20583135 Data show that IGFBP5 expression is down-regulated during 4HPR-induced neuronal differentiation of human RPE cells through a MAPK signal transduction pathway involving C/EBPbeta.
20508032 Data indicate that retinal astrocytes enhance the proliferation of cone-like retinoblastoma cells by deploying IGFBP5, a factor that also provides trophic support to the tumor cells' non-neoplastic counterparts.
20468064 Observational study of gene-disease association. (HuGE Navigator)
20416304 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20354179 insulin-like growth factor binding protein 5 is a modulator of tamoxifen resistance in breast cancer
20345844 Decreased Cav-1 expression in fibrotic diseases likely leads to increased deposition of IGFBP-5 in the extracellular matrix.
19950226 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19948051 Regulation of the IGFBP-5 and MMP-13 genes by the microRNAs miR-140 and miR-27a in human osteoarthritic chondrocytes.
19877176 OBSL1 modulates the expression of IGFBP2 and IGFBP5 proteins in 3-M syndrome.
19843326 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19808657 Insulin-like growth factor-binding protein-5 stimulates growth of human intestinal muscle cells by activation of Galphai3.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19628764 IGFBP-5 induces a fibrotic phenotype via the activation of MAPK signaling and the induction of nuclear Egr-1 that interacts with IGFBP-5 and promotes fibrotic gene transcription.
19625176 Observational study of gene-disease association. (HuGE Navigator)
19610136 These results indicate that IGFBP-5 expression affects the cell cycle and survival signal pathways and thus it may be an important mediator of pancreatic cancer cell growth.
19476635 Increased IGFBP-5 is associated with cervical intraepithelial neoplasia and cervical carcinoma.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19341485 Findings imply that the mutant form of IGFBP5 increases proliferation and motility of breast cancer cells and that mutation of the NLS in IGFBP5 results in localization of IGFBP5 in the cytoplasm.
19250630 PSA secreted by prostate cancer cells degrades IGFBP-5 and augments the IGF signal transduction.
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18957933 IGFBP5 has a gender-specific association with adiponectin, which may modulate the development of metabolic syndrome
18809517 Results suggest that NFI proteins are important regulators of IGFBP5 expression in human osteoblasts and thus in modulating IGFBP5 functions in bone.
18805800 mRNA levels of IGFBP5, a specific substrate for PAPP-A2 protease activity, were also significantly increased, suggesting a potential role for IGFBP5 in fetal and placental growth suppression during pre-eclampsia.
18775916 IGFBP-5 expression prevented tumor growth and inhibited tumor vascularity in a xenograft model of human ovarian cancer. These results are the first evidence showing that IGFBP-5 plays a role as tumor suppressor by inhibiting angiogenesis
18762576 IGFBP-5 promotes muscle cell differentiation by binding to and switching on the IGF-II auto-regulation loop.
18710598 IGFBP-5 plays an important role in the biology of breast cancer, especially in breast cancer metastasis [review]
18676680 Observational study of gene-disease association. (HuGE Navigator)
18665784 patients with poor diabetes control have lower levels of IGF-1, and greater IGFBP-1, IGFBP-5, and bone-specific alkaline phosphatase
18624948 Expression in gingival epithelial cells is associated with anti-apoptosis, migration and differentiation
18602100 A new approach for designing protein delivery systems using IGFBP-3/5 derived peptides based on the molecular mechanisms of IGF-independent activities of IGFBPs.
18373644 IGFBP2 and IGFBP5 play a role in the development of metastasis and may serve as useful markers to predict lymph node metastasis in patients with small (T1) invasive breast carcinomas.
18311789 There is a novel function of ADAM-12m in chondrocyte proliferation and cloning in osteoarthritic cartilage through enhanced bioavailability of IGF-1 from the IGF-1-IGFBP-5 complex by selective IGFBP-5 digestion.
18210156 Single nucleotide polymorphisms in IGFBP5 is associated with breast cancer
18210156 Observational study of gene-disease association. (HuGE Navigator)
18161051 IGFBP-5 inducible by gankyrin overexpression may be involved human hepatocarcinogenesis.
18085517 This suggests that IGFBP-5 possesses an IGF-independent suppressor function
17892529 Insulin-like growth factor-binding protein-5 enters vesicular structures but not the nucleus
17823924 Androgen suppressive therapy increases IGFBP5 in the bone marrow microenvironment and thereby may facilitate the progression of prostate cancer.
17804819 IGFBP-5 plays a role in the regulation of cellular senescence via a p53-dependent pathway and in aging-associated vascular diseases
17651454 Overexpression of IGFBP5 was associated with breast cancer
17595320 IGFBP-5 can interact with VDR to prevent RXR:VDR heterodimerization; IGFBP-5 may attenuate the 1,25(OH)2D3-induced expression of bone differentiation markers.
17496250 Phosphorylation and O-glycosylation both affected IGFBP-5 binding to heparin but not insulin-like growth factor binding or ternary complex formation with the acid-labile subunit.
17316888 A cDNA library consisting of 220 upregulated genes in tumour tissue was established and named as LSCC. Differential expression was confirmed in five of these genes, including IGFBP5, SQLE, RAP2B, CLDN1, and TBL1XR1.
17312271 Ratios between the IGFBPs and IGF(insulin-like growth factor), different IGFBPs, sequential proteolytic cleavage of IGFBPs, and association of activating proteinases are elements in the regulation of IGF receptor stimulation.
17290407 study shows that down-regulation of IGFBP-5 protein correlates with cervical carcinogenesis and does so at a preneoplastic stage
17242174 Promoter contains a CACCC-rich consensus sequence required for activation by MN1.
17071587 Overexpression of IGFBP-5 in mouse lung results in fibroblast activation, increased extracellular matrix deposition, and myofibroblastic changes.
17067554 Inhibition of endogenously produced IGFBP-5 is associated with Bim-dependent apoptosis in NB cells.
16865675 overexpression of IGFBP-5 may play a significant role in the malignant transformation of normal pancreatic epithelial cells
16716263 IGF-I and -II are chemotactic factors for mesenchymal progenitor cells; IGFBP-5 both modulates the IGF-I effect and directly stimulates migration of human mesenchymal progenitor cells
16543235 there are several conserved residues in the IGFBP-5 N-terminal region that are critical for transactivation and IGFBP-2 and -3 also have strong transactivation activity in their N-domains
16311053 In conclusion, our findings are consistent with the hypothesis that FHL-2 and ADAM-9 are important modulators of IGFBP-5 actions and are, in part, regulated in a coordinated manner in bone
16195401 Importance of the kinetics of association/dissociation in determining the enhancing or inhibiting effects of IGFBP-5 and the ability to generate an IGFBP-5 mutant with exclusively IGF-enhancing activity.
16007340 IGFBP-5 interacts with RASSF1C
15930103 Igfbp5-mediated fibroblast growth factor receptor 2-IIIb signals regulate the genetic program that controls the structure of the hair shaft medulla in transgenic mice.
15802501 IGFBP-5 expression may influence extrinsic apoptotic pathways via a differential modulation of downstream cell survival and cell death pathways.
15780948 In that IGFBP-5 is thought to stimulate transgenic bone formation, directly or via the action of insulin-like growth factor 1, such changes in bone IGFBP-5 may be important to ensure robust bone acquisition in the early postnatal period.
15777798 Activation by C/EBP alpha and beta did not depend on their binding to the C/EBP site, since they still activated IGFBP-5 promoter.
15681824 Insulin-like growth factor binding proteins 3 and 5 are xpressed in idiopathic pulmonary fibrosis and have a role in extracellular matrix deposition
15661050 The expression of certain IGFBP is significantly altered in renal cell carcinoma
15650232 IGFBP-5 has a role in growth and differentiation of neuroblastoma cells
15618969 Inhibition of expression of IGFBP-5 by micro and small interfering RNA has marked effect on neuroblastoma cell proliferation, apoptosis, and differentiation
15534875 Understanding the mechanism of how cleavage of IGFBP-5 by this protease (IGFBPase) alters its activity will help to further our understanding of the biologic actions of the IGFs
15155755 exogenous IGFBP-5 increases apoptosis by binding to and inhibiting the activities of insulin-like growth factors
15140223 IGF-II:VN and IGF-I:IGFBP-5:VN complexes may be useful in situations where enhanced keratinocyte cell migration and proliferation is required, such as in wound healing and skin regeneration.
15001525 The IGFBP-5 C-domain is necessary and sufficient for its nuclear localization, and residues K206, K208, K217, and K218 are particularly critical. The IGFBP-5 N-domain contains a putative transactivation domain.
14645245 Fibronectin and IGFBP-5 bind to each other, and this binding negatively regulates the ligand-dependent action of IGFBP-5 by triggering IGFBP-5 proteolysis.
12777377 IGFBP-5 is a potent growth inhibitor and proapoptotic agent in human breast cancer cells via modulation of cell cycle regulation and apoptotic mediators
12005306 cDNA probes were used to analyze the gene expression of IGFBP-5 in luteinized granulosa cells from different-sized follicles after ovarian hyperstimulation. Transcript levels increased with increasing follicular fluid (FF) volume
11973331 c-Myb and B-Myb transactivate the IGFBP-5 promoter through binding-dependent and -independent mechanisms.
11923300 role in stimulating growth and IGF-I secretion in intestinal smooth muscle by ras-dependent activation of MAP kinase signaling pathways
11821401 Insulin-like growth factor-binding protein 5 (IGFBP-5) interacts with a four and a half LIM protein 2 (FHL2).

AA Sequence

MVLLTAVLLLLAAYAGPAQSLGSFVHCEPCDEKALSMCPPSPLGCELVKEPGCGCCMTCALAEGQSCGVY      1 - 70
TERCAQGLRCLPRQDEEKPLHALLHGRGVCLNEKSYREQVKIERDSREHEEPTTSEMAEETYSPKIFRPK     71 - 140
HTRISELKAEAVKKDRRKKLTQSKFVGGAENTAHPRIISAPEMRQESEQGPCRRHMEASLQELKASPRMV    141 - 210
PRAVYLPNCDRKGFYKRKQCKPSRGRKRGICWCVDKYGMKLPGMEYVDGDFQCHTFDSSNVE            211 - 272
//

Text Mined References (144)

PMID Year Title
26103640 2015 IGFBP-5 Promotes Fibrosis Independently of Its Translocation to the Nucleus and Its Interaction with Nucleolin and IGF.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
26010068 2015 Insulin-like growth factor binding protein 5 (IGFBP5) functions as a tumor suppressor in human melanoma cells.
25827480 2015 Demethylation of IGFBP5 by Histone Demethylase KDM6B Promotes Mesenchymal Stem Cell-Mediated Periodontal Tissue Regeneration by Enhancing Osteogenic Differentiation and Anti-Inflammation Potentials.
25603050 2015 MiR-204-5p suppresses cell proliferation by inhibiting IGFBP5 in papillary thyroid carcinoma.
25548030 2015 Insulinlike Growth Factor-1 and Its Binding Protein-3 Polymorphisms Predict Circulating IGF-1 Level and Appendicular Skeletal Muscle Mass in Chinese Elderly.
25475528 2014 IGFBP-4 and -5 are expressed in first-trimester villi and differentially regulate the migration of HTR-8/SVneo cells.
25436638 2014 Genetic variants associated with serum thyroid stimulating hormone (TSH) levels in European Americans and African Americans from the eMERGE Network.
25422220 2014 Detection of PIK3CA gene mutations with HRM analysis and association with IGFBP-5 expression levels in breast cancer.
25248036 2014 Evidence that breast cancer risk at the 2q35 locus is mediated through IGFBP5 regulation.
25007054 2014 Evidence that RASSF1C stimulation of lung cancer cell proliferation depends on IGFBP-5 and PIWIL1 expression levels.
24551065 2014 The membrane-associated adaptor protein DOK5 is upregulated in systemic sclerosis and associated with IGFBP-5-induced fibrosis.
24379630 2013 Serum concentrations of insulin-like growth factor-binding protein 5 in Crohn's disease.
24120850 2013 IGFBP-5 enhances epithelial cell adhesion and protects epithelial cells from TGF?1-induced mesenchymal invasion.
23665505 2013 IGFBP5 domains exert distinct inhibitory effects on the tumorigenicity and metastasis of human osteosarcoma.
23576565 2013 DOG1 regulates growth and IGFBP5 in gastrointestinal stromal tumors.
23539739 2013 IGFBP-5 overexpression as a poor prognostic factor in patients with urothelial carcinomas of upper urinary tracts and urinary bladder.
23499909 2013 Insulin-like growth factor binding protein-4 and -5 modulate ligand-dependent estrogen receptor-? activation in breast cancer cells in an IGF-independent manner.
23408906 2013 A meta-analysis of thyroid-related traits reveals novel loci and gender-specific differences in the regulation of thyroid function.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
22571677 2012 Influence of vascular endothelial growth factor on the expression of insulin-like growth factor-II, insulin-like growth factor binding protein-2 and 5 in human luteinized granulosa cells.
22328518 2012 IGFBP5 induces cell adhesion, increases cell survival and inhibits cell migration in MCF-7 human breast cancer cells.
22252554 2012 c-Src and IL-6 inhibit osteoblast differentiation and integrate IGFBP5 signalling.
22246875 2012 Impaired expression of insulin-like growth factor-1 system in skeletal muscle of amyotrophic lateral sclerosis patients.
22117064 2012 Defining the disulfide bonds of insulin-like growth factor-binding protein-5 by tandem mass spectrometry with electron transfer dissociation and collision-induced dissociation.
21852217 2012 Insulin-like growth factor axis gene polymorphisms modify risk of pancreatic cancer.
21460855 2011 Insulin-like growth factor binding protein 5 suppresses tumor growth and metastasis of human osteosarcoma.
21256825 2011 Insulin-like growth factor-binding protein-5 (IGFBP-5) inhibits TNF-?-induced NF-?B activity by binding to TNFR1.
21191810 2011 Involvement of IGF binding protein 5 in prostaglandin E(2)-induced cellular senescence in human fibroblasts.
21029365 2011 Fibrotic response in fibroblasts from congenital disorders of glycosylation.
20949447 2011 Association between a functional polymorphism (-1195T>C) in the IGFBP5 promoter and head and neck cancer risk.
20944648 2011 Effects of IGF-binding protein 5 in dysregulating the shape of human hair.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20810604 2010 Eighteen insulin-like growth factor pathway genes, circulating levels of IGF-I and its binding protein, and risk of prostate and breast cancer.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20634197 2010 Comprehensive analysis of common genetic variation in 61 genes related to steroid hormone and insulin-like growth factor-I metabolism and breast cancer risk in the NCI breast and prostate cancer cohort consortium.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20583135 2010 Decreased expression of insulin-like growth factor binding protein-5 during N-(4-hydroxyphenyl)retinamide-induced neuronal differentiation of ARPE-19 human retinal pigment epithelial cells: regulation by CCAAT/enhancer-binding protein.
20508032 2010 Tumor-associated retinal astrocytes promote retinoblastoma cell proliferation through production of IGFBP-5.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20416304 2010 Insulin-like growth factor axis gene polymorphisms and clinical outcomes in pancreatic cancer.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20354179 2010 Genetic screen identifies insulin-like growth factor binding protein 5 as a modulator of tamoxifen resistance in breast cancer.
20345844 2011 Decreased caveolin-1 levels contribute to fibrosis and deposition of extracellular IGFBP-5.
19950226 2010 Single nucleotide polymorphisms in miRNA binding sites and miRNA genes as breast/ovarian cancer risk modifiers in Jewish high-risk women.
19948051 2009 Regulation of the IGFBP-5 and MMP-13 genes by the microRNAs miR-140 and miR-27a in human osteoarthritic chondrocytes.
19877176 2010 OBSL1 mutations in 3-M syndrome are associated with a modulation of IGFBP2 and IGFBP5 expression levels.
19843326 2009 Genetic variation in insulin-like growth factor signaling genes and breast cancer risk among BRCA1 and BRCA2 carriers.
19808657 2009 Insulin-like growth factor-binding protein-5 stimulates growth of human intestinal muscle cells by activation of G{alpha}i3.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19628764 2009 The fibrotic phenotype induced by IGFBP-5 is regulated by MAPK activation and egr-1-dependent and -independent mechanisms.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19610136 2009 Insulin-like growth factor binding protein-5 influences pancreatic cancer cell growth.
19476635 2009 Expressions of IGFBP-5, cFLIP in cervical intraepithelial neoplasia, cervical carcinoma and their clinical significances: a molecular pathology.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19341485 2009 The subcellular localization of IGFBP5 affects its cell growth and migration functions in breast cancer.
19250630 2009 Prostate-specific antigen enhances bioavailability of insulin-like growth factor by degrading insulin-like growth factor binding protein 5.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
18957933 2009 Association of sequence variations in the gene encoding insulin-like growth factor binding protein 5 with adiponectin.
18809517 2009 Nuclear factor I transcription factors regulate IGF binding protein 5 gene transcription in human osteoblasts.
18805800 2008 Increased levels of pregnancy-associated plasma protein-A2 in the serum of pre-eclamptic patients.
18775916 2008 Insulin-like growth factor-binding protein-5 (IGFBP-5) acts as a tumor suppressor by inhibiting angiogenesis.
18762576 2008 IGFBP-5 regulates muscle cell differentiation by binding to IGF-II and switching on the IGF-II auto-regulation loop.
18710598 2008 Multifunctional roles of insulin-like growth factor binding protein 5 in breast cancer.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18665784 2008 IGF-1 and IGF-binding proteins and bone mass, geometry, and strength: relation to metabolic control in adolescent girls with type 1 diabetes.
18624948 2008 Insulin-like growth factor binding protein-5 enhances the migration and differentiation of gingival epithelial cells.
18602100 2008 Intracellular protein delivery activity of peptides derived from insulin-like growth factor binding proteins 3 and 5.
18373644 IGFBP2 and IGFBP5 overexpression correlates with the lymph node metastasis in T1 breast carcinomas.
18311789 2008 ADAM-12 (meltrin alpha) is involved in chondrocyte proliferation via cleavage of insulin-like growth factor binding protein 5 in osteoarthritic cartilage.
18210156 2008 Genetic variation in IGFBP2 and IGFBP5 is associated with breast cancer in populations of African descent.
18161051 2008 Association of gankyrin protein expression with early clinical stages and insulin-like growth factor-binding protein 5 expression in human hepatocellular carcinoma.
18085517 2008 Insulin-like growth factor binding protein-5 (IGFBP-5) suppresses the tumourigenesis of head and neck squamous cell carcinoma.
17892529 2007 Insulin-like growth factor-binding protein-5 enters vesicular structures but not the nucleus.
17823924 2007 Regulation of global gene expression in the bone marrow microenvironment by androgen: androgen ablation increases insulin-like growth factor binding protein-5 expression.
17804819 2007 Induction of cellular senescence by insulin-like growth factor binding protein-5 through a p53-dependent mechanism.
17651454 2007 Expression level of insulin-like growth factor binding protein 5 mRNA is a prognostic factor for breast cancer.
17595320 2007 Insulin-like growth factor binding protein-5 interacts with the vitamin D receptor and modulates the vitamin D response in osteoblasts.
17496250 2007 The in vivo phosphorylation and glycosylation of human insulin-like growth factor-binding protein-5.
17316888 2007 Identification of genes differentially expressed in human primary lung squamous cell carcinoma.
17312271 2007 Regulation of insulin-like growth factor (IGF) bioactivity by sequential proteolytic cleavage of IGF binding protein-4 and -5.
17290407 2007 Down-regulation of insulin-like growth factor binding protein-5 (IGFBP-5): novel marker for cervical carcinogenesis.
17242174 2007 The MN1 oncoprotein activates transcription of the IGFBP5 promoter through a CACCC-rich consensus sequence.
17071587 2006 Insulin-like growth factor-binding protein-5 induces pulmonary fibrosis and triggers mononuclear cellular infiltration.
17067554 2006 Bim-dependent apoptosis follows IGFBP-5 down-regulation in neuroblastoma cells.
16865675 2006 Differential expression of insulin-like growth factor binding protein-5 in pancreatic adenocarcinomas: identification using DNA microarray.
16716263 2006 IGF-I and IGF-II stimulate directed cell migration of bone-marrow-derived human mesenchymal progenitor cells.
16543235 2006 Several acidic amino acids in the N-domain of insulin-like growth factor-binding protein-5 are important for its transactivation activity.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16311053 2006 Regulation of insulin-like growth factor binding protein-5, four and a half lim-2, and a disintegrin and metalloprotease-9 expression in osteoblasts.
16195401 2006 Cumulative mutagenesis of the basic residues in the 201-218 region of insulin-like growth factor (IGF)-binding protein-5 results in progressive loss of both IGF-I binding and inhibition of IGF-I biological action.
16007340 2005 Ras-association domain family 1 protein, RASSF1C, is an IGFBP-5 binding partner and a potential regulator of osteoblast cell proliferation.
15930103 2005 FGF signals specifically regulate the structure of hair shaft medulla via IGF-binding protein 5.
15802501 2005 Enhancement of tumor necrosis factor-alpha-induced growth inhibition by insulin-like growth factor-binding protein-5 (IGFBP-5), but not IGFBP-3 in human breast cancer cells.
15780948 2005 Osteoblast-specific expression of insulin-like growth factor-1 in bone of transgenic mice induces insulin-like growth factor binding protein-5.
15777798 2005 C/EBP alpha and beta mimic retinoic acid activation of IGFBP-5 in neuroblastoma cells by a mechanism independent from binding to their site.
15700281 2005 Insulin-like growth factor binding protein-5 (IGFBP-5) interacts with thrombospondin-1 to induce negative regulatory effects on IGF-I actions.
15681824 2005 Insulin-like growth factor binding proteins 3 and 5 are overexpressed in idiopathic pulmonary fibrosis and contribute to extracellular matrix deposition.
15661050 2005 Altered messenger RNA and protein expressions for insulin-like growth factor family members in clear cell and papillary renal cell carcinomas.
15650232 2004 Insulin-like growth factor binding protein 5: contribution to growth and differentiation of neuroblastoma cells.
15618969 2005 Silencing of endogenous IGFBP-5 by micro RNA interference affects proliferation, apoptosis and differentiation of neuroblastoma cells.
15534875 2005 Expression and characterization of a serine protease that preferentially cleaves insulin-like growth factor binding protein-5.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15155755 2004 Paradoxical actions of endogenous and exogenous insulin-like growth factor-binding protein-5 revealed by RNA interference analysis.
15140223 2004 Insulin-like growth factors (IGF) and IGF-binding proteins bound to vitronectin enhance keratinocyte protein synthesis and migration.
15001525 2004 Evidence that IGF binding protein-5 functions as a ligand-independent transcriptional regulator in vascular smooth muscle cells.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
14645245 2004 Fibronectin binds insulin-like growth factor-binding protein 5 and abolishes Its ligand-dependent action on cell migration.
12810534 2003 Structural and functional evidence for the interaction of insulin-like growth factors (IGFs) and IGF binding proteins with vitronectin.
12777377 2003 Insulin-like growth factor-binding protein-5 inhibits the growth of human breast cancer cells in vitro and in vivo.
12766061 2003 Gene expression profile of the human trabecular meshwork: NEIBank sequence tag analysis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12466191 2002 Cellular actions of the insulin-like growth factor binding proteins.
12005306 2002 Expression of insulin-like growth factor (IGF), IGF receptor, and IGF-binding protein messenger ribonucleic acids in luteinized granulosa cells from different size follicles after controlled ovarian hyperstimulation.
11973331 2002 Expression of insulin-like growth factor-binding protein 5 in neuroblastoma cells is regulated at the transcriptional level by c-Myb and B-Myb via direct and indirect mechanisms.
11923300 2002 Insulin-like growth factor-binding protein-5 (IGFBP-5) stimulates growth and IGF-I secretion in human intestinal smooth muscle by Ras-dependent activation of p38 MAP kinase and Erk1/2 pathways.
11905402 2001 Effect of nitric oxide on the expression of insulin-like growth factors and the insulin-like growth factor binding proteins throughout the lifespan of the human corpus luteum.
11874691 2002 IGF-binding protein-5: flexible player in the IGF system and effector on its own.
11821401 2002 Insulin-like growth factor-binding protein 5 (IGFBP-5) interacts with a four and a half LIM protein 2 (FHL2).
11751588 2002 Vitronectin binding to IGF binding protein-5 (IGFBP-5) alters IGFBP-5 modulation of IGF-I actions.
11297622 2001 Transferrin is an insulin-like growth factor-binding protein-3 binding protein.
11264294 2001 Pregnancy-associated plasma protein-A2 (PAPP-A2), a novel insulin-like growth factor-binding protein-5 proteinase.
11095942 2000 ADAM 12-S cleaves IGFBP-3 and IGFBP-5 and is inhibited by TIMP-3.
10811646 2000 Nuclear import of insulin-like growth factor-binding protein-3 and -5 is mediated by the importin beta subunit.
10766744 2000 Substitutions for hydrophobic amino acids in the N-terminal domains of IGFBP-3 and -5 markedly reduce IGF-I binding and alter their biologic actions.
10698186 2000 Thrombospondin and osteopontin bind to insulin-like growth factor (IGF)-binding protein-5 leading to an alteration in IGF-I-stimulated cell growth.
10336724 1999 Characterization of the insulin-like growth factor axis in the human thymus.
9883900 1998 Isolation and characterization of circulating 13-kDa C-terminal fragments of human insulin-like growth factor binding protein-5.
9822601 1998 Structure of the IGF-binding domain of the insulin-like growth factor-binding protein-5 (IGFBP-5): implications for IGF and IGF-I receptor interactions.
9786878 1998 Insulin-like growth factor-binding protein 5 complexes with the acid-labile subunit. Role of the carboxyl-terminal domain.
9528953 1998 Insulin-like growth factor-binding protein-5 is cleaved by physiological concentrations of thrombin.
9497324 1998 Insulin-like growth factor (IGF)-binding protein 5 forms an alternative ternary complex with IGFs and the acid-labile subunit.
9202242 1997 Insulin-like growth factor binding protein-5 binds to plasminogen activator inhibitor-I.
9110174 1997 Large-scale concatenation cDNA sequencing.
8817691 1995 Age-related changes in IGFBP-4 and IGFBP-5 levels in human serum and bone: implications for bone loss with aging.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
7559606 1995 Transcription factor AP-2 regulates human insulin-like growth factor binding protein-5 gene expression.
7525452 1994 Identification of two clusters of mouse insulin-like growth factor binding protein genes on chromosomes 1 and 11.
7511611 1994 Characterization of the chromosomal gene and promoter for human insulin-like growth factor binding protein-5.
7511544 1993 Insulin-like growth factor binding proteins in the human adrenal gland.
1850258 1991 Molecular cloning of a new human insulin-like growth factor binding protein.
1850257 1991 A novel human insulin-like growth factor binding protein secreted by osteoblast-like cells.
1710112 1991 Structure and localization of the human insulin-like growth factor-binding protein 2 gene.
1709938 1991 Identification of five different insulin-like growth factor binding proteins (IGFBPs) from adult rat serum and molecular cloning of a novel IGFBP-5 in rat and human.