Property Summary

Ligand Count 39
NCBI Gene PubMed Count 628
PubMed Score 2176.50
PubTator Score 2165.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 272 0.0 0.9

Expression

  Differential Expression (28)

Disease log2 FC p
adrenocortical carcinoma 2.353 2.2e-08
astrocytoma 1.100 1.9e-04
autosomal dominant Emery-Dreifuss muscul... 1.288 2.9e-02
breast carcinoma -1.300 1.9e-05
cystic fibrosis and chronic rhinosinusit... 1.486 3.6e-02
dermatomyositis 1.600 2.5e-02
Duchenne muscular dystrophy 1.689 3.3e-05
ependymoma 1.400 2.4e-02
esophageal adenocarcinoma 2.400 1.8e-02
glioblastoma 1.200 6.5e-03
group 4 medulloblastoma -1.100 2.7e-02
intraductal papillary-mucinous adenoma (... -1.800 4.9e-02
juvenile dermatomyositis 1.650 3.6e-09
lung adenocarcinoma 1.400 1.4e-03
lung cancer 2.200 7.1e-05
medulloblastoma, large-cell -2.700 2.1e-05
non-small cell lung cancer 2.222 6.2e-17
oligodendroglioma 1.300 3.6e-06
ovarian cancer 1.200 3.9e-02
pancreatic cancer 2.800 4.8e-07
pancreatic ductal adenocarcinoma liver m... -1.601 2.6e-02
pediatric high grade glioma 1.300 2.0e-04
pituitary cancer -1.900 1.1e-03
primary Sjogren syndrome 1.500 1.5e-02
psoriasis 1.600 4.3e-02
pterygium -1.400 1.4e-02
tuberculosis -1.200 3.3e-03
ulcerative colitis 1.900 6.3e-05

Protein-protein Interaction (1)

Gene RIF (605)

AA Sequence

MQRARPTLWAAALTLLVLLRGPPVARAGASSAGLGPVVRCEPCDARALAQCAPPPAVCAELVREPGCGCC      1 - 70
LTCALSEGQPCGIYTERCGSGLRCQPSPDEARPLQALLDGRGLCVNASAVSRLRAYLLPAPPAPGNASES     71 - 140
EEDRSAGSVESPSVSSTHRVSDPKFHPLHSKIIIIKKGHAKDSQRYKVDYESQSTDTQNFSSESKRETEY    141 - 210
GPCRREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTTKGK    211 - 280
EDVHCYSMQSK                                                               281 - 291
//

Text Mined References (634)

PMID Year Title