Property Summary

NCBI Gene PubMed Count 235
PubMed Score 1132.43
PubTator Score 1034.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
cystic fibrosis -2.799 1.8e-06
glioblastoma 1.200 5.0e-02
pancreatic cancer 2.000 7.0e-03
pediatric high grade glioma 1.200 5.0e-03
inflammatory breast cancer -1.200 3.4e-04
ovarian cancer -1.100 1.3e-04

Gene RIF (204)

PMID Text
26714229 mTOR inhibition constitutes a mechanistic link between hypoxia, reduced IGF-I bioavailability and fetal growth retardation.
26456333 the hepatokine IGFBP1 is a critical liver-bone hormonal relay that promotes osteoclastogenesis and bone resorption as well as an essential mediator of FGF21-induced bone loss
26245897 study shows up-regulation of MCSF in GBM via a SYK-PI3K-NFkappaB-dependent mechanism and identifies IGFBP1 released by microglial cells as a novel mediator of MCSF-induced angiogenesis
26232425 Activation of IGFBP1 by pregnane X receptor alters the morphology of hepatocellular carcinoma cells and regulates cell migration.
26118397 trend towards higher cord blood values in intrauterine growth restriction observed
26025665 gene expression analysis of human breast tumors showed that high expression of IGFBP mRNA was strongly correlated with good prognosis but not when MMP9 mRNA was also highly expressed
25957086 The amino acid response and mTOR independently regulate IGFBP-1 secretion and phosphorylation in response to decreased amino acid availability.
25890304 There was a positive correlation between the IGFBP1 levels of and those of inflammatory mediators in HIV Infections.
25869614 Data suggest that expression of IGFBP1 in hepatocytes can be regulated by carnosine, a dietary factor; carnosine down-regulates expression of IGFBP1 in Hep G2 cells; mechanism involves suppression of HIF1A (hypoxia inducible factor 1 alpha subunit).
25757011 HIF-2alpha acts as an important negative regulator of hepatic lymphangiogenesis in vitro and in vivo by inducing IGFBP1.
25746666 Variations in relative quantities of IGFBP-1 monomers and complexes in different tumor types were much more pronounced than those of IGFBP-2.
25620704 The gene expression of insulin-like growth factor binding protein 1 (IGFBP1) increases in cells infected with vpu-deficient HIV-1 compared to cells infected with the wild-type virus, indicating that HIV-1 Vpu downregulates IGFBP1 protein expression
25597167 The predictive value of IGFBP1 in cervical secretion as bedside test for prediction of preterm labor in symptomatic women was studied.
25543125 Insulin-like growth factor 1 receptor blockade can inhibit glioblastoma growth by different mechanisms, including direct effects on the tumor cells as well as indirect anti-angiogenic effects.
25461385 IGF-1 and IGF-binding protein-1 have roles in metabolic syndrome and ECG detected left ventricular hypertrophy
25348852 Results show that higher prediagnostic fasting IGFBP-1 levels were associated with lower risk of prostate cancer, whereas higher IGF-1 levels were associated with increased prostate cancer risk.
25337205 Suggest that IGFBP-1 inhibits the invasion and metastasis of HCC cells and that IGFBP-1 may be useful as a valuable marker for the prognosis of patients with HCC.
25123037 IGFBP1 in epithelial circulating tumor cells as a potential response marker to selective internal radiation therapy in hepatocellular carcinoma
24919336 According to this study IGFBP-1 is a specific marker for preterm delivery in pregnant women with clinical symptoms.
24856042 term placental explants, but not their conditioned medium, can de-phosphorylate IGFBP-1 through the action of placental alkaline phosphatase
24667918 The gene expression of insulin-like growth factor binding protein 1 (IGFBP1) increases in cells infected with vpu-deficient HIV-1 compared to cells infected with the wild-type virus, indicating that HIV-1 Vpu downregulates IGFBP1 protein expression
24612210 Data suggest that up-regulation of IGFBP1 in vaginal smears (as a biological marker for presence of amniotic fluid) may be useful point-of-care test for diagnosis of premature rupture of fetal membranes.
24513543 This paper provides a brief overview of the structure and regulation of IGFBP-rP1 and its various biological functions in cancer--{review}
24436153 In the second trimester, rapid cervical phIGFBP-1 testing in asymptomatic twin pregnancies has a poor performance in predicting spontaneous preterm delivery
24248464 C/EBPbeta regulates the expression of IGFBP-1 and PRL by altering the histone acetylation status of their promoters but differently regulates Mn-SOD gene expression in human ESC during decidualization
24132762 elevated insulin-like growth factor binding protein 1 appears to be associated with shorter time to castration resistant prostate cancer and lower overall survival in men with metastatic prostate cancer
24056811 DeltaIGFBP-1 as a biomarker of hepatic insulin resistance
23942851 Pyridoxal may induce the expression of IGFBP1 in hepatoma cells via a mechanism involving the ERK/cJun pathway.
23815140 Data suggest that low oxygen conditions inhibit IGF1 action in hepatocytes by up-regulating IGFBP1, especially up-regulating phosphorylated IGFBP1, which inhibits IGF1 action.
23603247 FOXO1/IGFBP-1 axis is essential for PRB-dependent growth inhibition of endometrial epithelial cells
23585335 Serum glycodelin levels did not predict endometrial receptivity in patients undergoing in vitro fertilization.
23408645 The median concentrations of first-trimester vaginal and cervical phIGFBP-1 are higher in women with spontaneous preterm delivery at <32 and <37 weeks gestation.
23354097 IGFBP-1 phosphorylation at S119 can enhance affinity for IGF-I possibly through stabilization of the IGF-IGFBP-1 complex.
23190203 Data from a longitudinal study of healthy pregnant women in Sweden suggest that IGFBP-1 is increased in maternal plasma during normal pregnancy compared to postpartum period; two peaks, at week 17-24 and just before delivery, are observed.
23183724 Amniotic fluid samples collected after labour onset contained proteolytic activity that generated 12- and 19-kDa IGFBP-1 fragments that did not bind to 125I-IGF-I. This activity was not detected in amniotic fluid collected prior to labour onset.
23095194 Value of testing two biomarkers, based on soluble intercellular adhesion molecule-1 (Leakection) and insulin like growth factor-binding protein-1 (Amnioquick), for the diagnosis of prelabor rupture of membranes. Both show high sensitivity and specificity.
22894543 Common IGF-1 and IGFBP-1/IGFBP-3 SNPs are not associated with body size in early life.
22843786 These results show that RTEF-1-stimulated IGFBP-1 expression may be central to the mechanism by which RTEF-1 attenuates blood glucose levels.
22745191 Data show that HMGA1 is required for gene activation of the IGF-binding proteins 1 (IGFBP1) and 3 (IGFBP30).
22554827 IGFBP-1 and IGFBP-2 have strong inverse associations with risk of type 2 diabetes risk in women
22442270 Among older adults, decreasing IGF-I level over time does not predict subsequent all-cause mortality, whereas increasing IGFBP-1 predicts increased risk of mortality.
22357965 The effects of hIGFBP1 on insulin sensitivity, blood pressure, NO production, and atherosclerosis suggest that increasing IGFBP1 concentration may be a novel approach to prevent cardiovascular disease in the setting of insulin resistance and diabetes.
22325929 IGFBP-1 has been identified by a protein array approach as a potential novel biomarker of abdominal aortic aneurysm.
22239027 Preoperative IGFBP1 is lower in patients with uterine polyps than in menorrhagia, but increase postoperatively. This could explain the pathophysiological mechanisms for impaired endometrial receptivity in the presence of endometrial polyps.
22187946 The degradation of IRS-1 by HCV core protein translates to impaired ability of insulin to inhibit the expression of the target gene IGFBP-1 in the liver and may serve as a novel mechanism for insulin resistance and hyperglycemia.
22113073 In older men, higher IGF1 and an increased ratio of IGF1/IGFBP3 are associated with abdominal aortic aneurysm, while IGFBP1 is independently associated with increased aortic diameter.
22104117 IGFBP-1 mRNA and protein is detected at increased levels in human carotid plaques, possibly as a consequence of plaque inflammation, affecting smooth muscle cell proliferation.
22072736 In endometriotic stromal cells, overactivation of the phosphatidylinositol 3-kinase/AKT signaling pathway contributes to the reduced expression of the decidua-specific gene, IGFBP1, potentially through reduced levels of nuclear FOXO1.
21940708 The essential roles of 4 Rho GTPases and 2 RHO kinases in IGFBP1-mediated migration of an immortalized EVT cell line HTR-8/SVneo are reported.
21933314 Cardiac morphological data were negatively correlated with IGGBP-1 and positively correlated with IGF-I and birth weight.
21930730 High IGFBP-1 levels were inversely associated with a risk of Barrett's oesophagus.
21892205 Insulin-like growth factor-binding protein-1 (IGFBP-1) regulates human schwannoma proliferation, adhesion and survival.
21852217 We genotyped single-nucleotide polymorphisms of IGF1, IGF2, IGF1R, IGF2R, IGFBP1, IGFBP3, IGFBP5, IRS1, IRS2, and IRS in pancreatic cancer patients
21741060 The IGFBP-1 was significantly lower in NGT subjects with IR as measured by the homeostasis model assessment.
21521316 Data show that leptin is better than any other biological parameter for monitoring the efficacy of renutrition, including albumin, transthyretin, leptin, IGFBP-1, IGFBP-3 and IGF-1.
21457161 IGFBP-1 is expressed specifically in ovarian clear cell adenocarcinoma
21378090 Increased circulating levels of IGFBP1 predict increased all-cause mortality in Australian men.
21247237 In women with a cervix </=30 mm, adding phIGFBP-1 assessment may improve the risk assessment for preterm delivery.
21212012 Decreased placental expression of hPGH, IGF-I and IGFBP-1 in pregnancies complicated by fetal growth restriction.
21198359 The strong relationships between IGFBP-1, insulin resistance, and the MetS suggest that IGFBP-1 might be a promising marker for these entities in obesity.
21140206 independent effects from IGFBP1, IGFBP3 diplotypes, and BRCA family status on IGFBP-3 levels were observed
21104586 IGFBP-1 multimers found in the circulation of patients with diabetes type 2 differed from those detected in the circulation of others.
21078522 Polymorphisms in IGFI and IGFBP-1 were not associated with endometrial cancer risk, but further research is needed.
21078522 Observational study of gene-disease association. (HuGE Navigator)
20885978 TGFbeta1 down-regulated expression of prolactin and IGFBP-1 in endometrial stromal cells in SMAD4-dependent and SMAD4-independent manners.
20884247 Data indicate after 3 cycles of treatment IGF-1 significantly declined, IGFBP-1 significantly increased, and IGF-2 and IGFBP-3 were not significantly changed.
20810604 Observational study of gene-disease association. (HuGE Navigator)
20734064 Observational study of gene-disease association. (HuGE Navigator)
20731527 height and BMI are associated with IGF-I and its binding proteins, which may be mechanisms through which body size contributes to increased risk of several cancers
20711952 Vitamin D stimulates ovarian steroidogenesis and IGFBP-1 production in human ovarian cells.
20637724 These results suggest that increased IGFBP-1 levels are associated with the severity of renal pathology in patients with IgAN.
20634197 Meta-analysis of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20587581 Sleeping during the day results in higher levels of IGFBP1 than during nocturnal sleep and suggests altered metabolism among healthy individuals.
20484221 A comprehensive analysis, between common genetic variation in the IGF1, IGF binding protein (BP) 1, and IGFBP3 genes with IGF-I and IGFBP-3 blood levels, and prostate cancer (PCa) risk, among Caucasians, was conducted.
20484221 Observational study of gene-disease association. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20416304 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20413521 Copeptin is an independent predictor of cardiovascular events and appears to at least partly explain the prognostic impact of IGFBP-1 in patients with type 2 diabetes and myocardial infarction
20155489 Findings suggest that common genetic variation in the IGFBP1 gene is weakly related to IGF-I levels and mammographic density.
20155489 Observational study of gene-disease association. (HuGE Navigator)
20149700 Catch-up growth, GHRd3, and IGFBP-1 -575G/A did not influence fasting insulin or HOMA-insulin resistance.
20149700 Observational study of gene-disease association. (HuGE Navigator)
20144192 Observational study of gene-disease association. (HuGE Navigator)
20143870 We suggest that site-specific increase in IGFBP-1 phosphorylation limits IGF-I bioavailability, which directly contributes to the development of FGR.
20102313 local expression of IGFBPs in podocytes and endothelial cells might contribute to the pathogenesis of glomerular disease and IGFBP-1 and -3 are potential non-invasive markers of focal segmental glomerulosclerosis.
20039319 Observational study of gene-disease association. (HuGE Navigator)
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19917654 IGFBP1, as a marker of insulin sensitivity, is relevant in the assessment of metabolic syndrome, while the IGF1/IGFBP3 ratio is less informative for risk factors
19913121 Observational study of gene-disease association. (HuGE Navigator)
19858071 IGF1, IGFBP1 and IGFBP3 genetic variants may have roles in ovarian cancer risk
19858071 Observational study of gene-disease association. (HuGE Navigator)
19843326 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19765076 Five serines were phosphorylated and, of these, four are localized in the central, weakly conserved, region, at positions 95, 98, 101 and 119, whereas one, Ser169, is in the C-terminal domain.
19732896 low serum concentrations of IGFBP-1 forms could have a role in coronary risk
19730683 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19551864 Observational study of gene-disease association. (HuGE Navigator)
19539506 cleavage of IGFBP-1 occurs at the tissue level and not in the circulation in a patient with multiple myeloma and dermatitis [case report]
19463807 Data describe the biological variation of serum insulin-like growth factor binding protein-1 (IGFBP-1) in individuals with different degrees of glucose tolerance.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19434535 IGF-1 levels and the value of IGF-1/IGFBP-3 are significantly increased, and serum IGFBP-3 level is markedly decreased in colorectal cancer patients.
19308628 Bone histomorphometry parameters were associated with low body weight, low estradiol levels, and increased levels of IGFBP-1, supporting the notion that estrogens and IGFs play regulatory roles in male bone turnover.
19193607 data demonstrate that phosphorylation at Ser(119) plays a significant role in modulating affinity of IGFBP-1 for IGF-I
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19158202 IGFBP-1 is modulated by polymorphic variability and seems to be an additional player in interactions between the IGF-IGFBP axis, glucose homeostasis, and lipid metabolism.
19158202 Observational study of gene-disease association. (HuGE Navigator)
19124510 Observational study of gene-disease association. (HuGE Navigator)
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18924579 IGF-I, IGFBP-1 and IGFBP-3 are all inversely related to adiposity in Hispanic children.
18828733 Observational study of gene-disease association. (HuGE Navigator)
18793810 Levels of IGFBP-1 consistently predicted heart failure both among survivors of a first acute myocardial infarct and their matched controls
18772238 IGFBP-1 phosphorylation may be a novel mechanism of an adaptive response to hypoxia and nutrient restriction in a tumor cell line.
18701096 The recombinant proteins of IGFBP1 (IGFBP-rP1)induce senescence-like growth arrest in colorectal cancer cells.
18676680 Observational study of gene-disease association. (HuGE Navigator)
18665784 patients with poor diabetes control have lower levels of IGF-1, and greater IGFBP-1, IGFBP-5, and bone-specific alkaline phosphatase
18636124 Observational study of gene-disease association. (HuGE Navigator)
18596909 the association between common genetic variation in the IGFBP1 genes in relation to circulating IGFBP-I levels and breast cancer risk
18596909 Observational study of gene-disease association. (HuGE Navigator)
18513511 High circulating IGFBP-1 level may be a CHF risk factor among older adults.
18496669 Low IGFBP-1 predicts the development of abnormal glucose regulation and, as an inhibitor of the insulin-like actions of insulin-like growth factors, elevated levels of IGFBP-1 after the development of diabetes may also play a pathophysiological role
18305566 in Ehlers-Danlos syndrome fibroblasts, abnormal integrin pattern inhibited the positive effect of insulin-like growth factor-binding protein-1 on cell migration
18259111 Higher early levels of the human milk IGF system might contribute to maturation of the infant gut.
18166823 Data concluded that low concentrations of IGFBP-1 associated with term preeclampsia may reflect maternal metabolic aberrations, indicating different etiologies in preeclampsia.
17972510 This study supports the role of IGFBP-1, -3 and -7 as potential tumour suppressor genes in human breast cancer.
17972051 Observational study of gene-disease association. (HuGE Navigator)
17914103 Observational study of gene-disease association. (HuGE Navigator)
17890489 plasma adiponectin has a role in regulating sex hormone and insulin-like growth factor levels, including SHBG, c-peptide, and IGFBP-1
17803702 The data indicate that serum free IGF-I and IGFBP-1 are implicated in early atherosclerosis.
17655506 [(125)I]-labeled IGFBP-2 and -3, but not IGFBP-1, were proteolyzed by Ca(2+)-activated m-calpain in vitro.
17640761 Ethanol induced the IGFBP-1 mRNA and protein in hepatoma cells up to 5-fold in a dose-dependent manner. A similar effect was observed in cultured human hepatocytes.
17634530 Expression of IGFBP1 is regulated by aberrant hypermethylation in breast cancer, implying that inactivation of these genes is involved in the pathogenesis of this malignancy.
17566087 Observational study of gene-disease association. (HuGE Navigator)
17566087 Common genetic variation in IGF1, IGF binding protein 1 (IGFBP1), and IGFBP3 influences circulating levels of IGF-I, IGFBP-1, and IGFBP-3.
17485842 Cadmium cation increases the production of IGFBP1.
17465992 Expression in tumor cells may reduce the anchorage-independent growth ability, leading to the marked loss of tumorigenicity.
17341623 First evidence is given for the occurrence of a second insulin response element (IRE) within the IGFBP-1 promoter sequences, IRE(cAMP-responsive unit), located 5'- to the cAMP-responsive unit.
17300730 Observational study of gene-disease association. (HuGE Navigator)
17264182 Circulating levels of total IGFBP1 were not associated with risk of total coronary events or ischemic stroke among older adults.
17164371 Observational study of gene-disease association. (HuGE Navigator)
17113753 circulating levels significantly higher in cancer patients than in controls
17062566 the IGFBP-1 gene is a primary target of peroxisome proliferator-activated receptors
17035411 Observational study of gene-disease association. (HuGE Navigator)
17035411 Common genetic variation in the IGFBP1 gene does not substantially influence prostate and breast cancer susceptibility.
16973813 We demonstrated an elevation of IGFBP-1 both systemically and peritendinously in response to prolonged acute exercise.
16924115 The structures reveal the mechanisms of insulin-like growth factor (IGF) signaling regulation via insulin-like growth factor-binding proteins (IGFBP) binding.
16868142 reduction in bioactive IGF-I may be related to the higher levels of free IGFBP-1 and the faster disappearance of IGFBP-1-bound IGF-I in glucose tolerance test in liver cirrhosis
16809446 antenatal growth retardation and delayed mineralization in transgenic mice are related to overexpressed fetal and maternal circulating human IGFBP-1
16776662 IGFBP-1, IGFBP-3 and IGF-I show acute changes following a glucose load and there are marked gender differences in these responses.
16687408 Endoplasmic reticulum stress induction of IGFBP-1 involves ATF4
16404426 Observational study of gene-disease association. (HuGE Navigator)
16338475 IGFBP1 and Follistatin-like 3 are highly up-regulated in intrauterine growth restriction in the placenta.
16337840 growth-restricted twins had high bone turnover, due to elevated IGFBP-1
16306374 Observational study of gene-disease association. (HuGE Navigator)
16306374 first genomic markers to be associated with diabetic microvascular complications within the human IGFBP1 gene
16293667 high concentrations of circulating IGFBP-1 are sufficient to cause fetal growth restriction in an animal model
16222695 Quantitative RNA analysis confirmed down-regulation of ferritin light polypeptide and insulin-like growth factor binding protein 1 in hydatiform mole increased incidence of gestational trophoblastic neoplasia.
16118248 Conditioned medium of decidualized ESC cultured with cyclic stretch increased IGFBP-1 secretion from decidualized ESC cultured under stationary conditions.
16041536 Environmental factors have profound effects on circulating IGF system components and on the relationship between IGFBP-1, IGF-I and related metabolic variables such as glucose tolerance.
16002526 Glucocorticoid treatment creates a complex environment in which insulin regulates IGFBP-1 expression through insulin response sequences.
15987847 IGF BP1 was associated with lower birth weight as measured in seconsd semestser amniotic fluid.
15987820 FOXO1A regulation of the IGFBP1 expression is cell type-dependent
15972819 The three-dimensional structure of the C-terminal domain was determined by x-ray crystallography to 1.8 Angstroms resolution. The fragment folds as a thyroglobulin type I domain and was found to bind the Fe(2+) ion in the crystals.
15959422 Maternal diabetes is associated with suppressed levels of IGFBP-1 in cord serum.
15890677 Transcription of IGF-binding protein-1 is stimulated by Foxo1 acetylated by p300.
15797461 The IGFBP-1 protein is synthesized as propeptides with a hydrophobic leader sequence, removal of which yields a mature protein composed of 3 recognizable domains of similar size.
15736102 in patients with type 2 diabetes there was a blunted increase in IGFBP-1 concentrations with nutritional deprivation
15613433 human endometrium is a target for insulin action in the regulation of IGFBP-1.
15598684 The presence of relative insulin resistance and low fasting IGFBP-1 levels in Asian Indians may contribute to their higher risk of developing diabetes and cardiovascular disease.
15166120 GH serum levels increased in response to hIGFBP-1 administration, even in the setting of normal IGF-I levels.
15070959 Metabolic, anthropometric, and nutritional factors are important determinants of IGFBP-1 levels in healthy men.
15070833 cleavage of IGFBP-1 is a novel mechanism in the control of placental development by matrix metalloproteases.
14764802 During first trimester, serum glycodelin and IGFBP-1 are markedly decreased in polycystic ovary syndrome (PCOS), implicating endometrial epithelial and stromal dysfunction during periimplantation and early pregnancy in early pregnancy loss.
14726451 Breeding impairment of human insulin-like growth factor-binding protein-1 transgenic males is due at least in part to alteration of spermatogenesis, leading to diminution of sperm production and of its quality. Minor impairment of steroidogenesis.
14715837 low baseline levels of insulin-like growth factor-I and insulin-like growth factor binding protein-1 increase the risk of fatal ischemic heart disease among elderly men and women independent of prevalent risk factors
14624764 Elevation of IGFBP-1 is associated with the metabolic disturbances in liver disease
14568572 IGFBP-1 and SHBG are equally sensitive to ambient insulin concentrations in human hepatoma cell cultures, and the production of both proteins is also attenuated by the IGFs.
12933666 elevations in circulating and tissue levels of IGFBP-1 may be an important mediator for the muscle catabolism observed in various stress conditions.
12882925 IGFBP-1 plays an important and potentially beneficial role in regulating metabolic and vascular homeostasis.
12870155 endurance training improves glucose disposal and increases insulin-like growth binding protein-1 and -3 in men and for IGFBP-1 becomes more pronounced with age
12861174 serum concentrations of insulin-like growth factor binding protein-1 are abnormal in antiphospholipid syndrome pregnancies
12843192 insulin-induced stimulation of progesterone or inhibition of IGFBP-1 production in human granulosa cells does not require MAPK activation, whereas similar effects of IGF-I are largely MAPK dependent.
12843178 possible stimulatory effect of endogenous GH on IGF and IGF-binding protein 1 levels during fasting.
12746836 IGFBP-1 is decreased in human prostate malignancy
12746292 When IGFBP-1 was added, prostate cancer LNCaP cell growth was reduced, and apoptosis was induced.
12679458 insulin-like growth factor binding protein-1 in the third trimester and cord blood were negatively correlated with birth weight
12571183 Follicular fluid IGF-1 and IGFBP-3 levels were not significantly different among the groups; however, follicular fluid IGFBP-1 levels were lower in those patients with moderate/severe endometriosis
12519841 data demonstrate for the first time that serum levels of IGFs (including free fractions) and IGFBPs are not increased in euthyroid Graves' patients with active thyroid eye disease
12493691 FKHR and HOXA10 interact directly and can function cooperatively to stimulate IGFBP-1 promoter activity in endometrial cells
12489207 Bone formation in the context of growth retardation induced by hIGFBP-1 overexpression in transgenic mice. Overexpression of hIGFBP-1 causes postnatal growth retardation and a delay in mineralization in transgenic mutant mice.
12351482 reduction of this protein is associated with thickening of the carotid wall in type 2 diabetes.
12163461 IGFBP-1 plays a role in placentation and suggests that IGFBP-1 has a pathological role in preeclampsia, a disorder characterized by shallow uterine invasion and altered placental development
12153746 Adolescents with IDDM are characterised by morning hypoinsulinaemia and high circulating IGFBP-1 concentrations
12150454 IGFBP-1 levels significantly predict distant recurrence and death in breast cancer patients; prognostic effects appear related to known effect of insulin on IGFBP-1 gene expression
12135130 circulating levels of IGF-1 and IGFBP-1 are significantly related to the extent of myocardial injury in patients with hypertrophic cardiomyopathy.
12082253 statistical relationships between IGF-BP1 and blood rheology in athletes
12006706 determination of blood levels in adult patients with severe liver disease before and after orthotopic liver transplantation
11972304 after adjustment for age, high serum concentrations carried an increased risk of total mortality due to cardiovascular and coronary heart disease
11969341 altered IGF-II and IGFBP-1 expression at the fetomaternal interface may be important in the pathophysiology of pre-eclampsia
11956162 reduced fertility in transgenic female mice overexpressing human IGFBP-1 are mainly due to an alteration of terminal follicular growth
11834727 Increases in free, unbound insulin-like growth factor I enhance insulin responsiveness in human hepatoma G2 cells in culture.
11793026 IGF-binding protein 1 (IGFBP1) gene variant is associated with overfeeding-induced metabolic changes. accumulation of abdominal visceral fat and the early symptoms of the metabolic syndrome.
11762714 IGFBP-1 is elevated in both hypothyroidism and hyperthyroidism

AA Sequence

MSEVPVARVWLVLLLLTVQVGVTAGAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAA      1 - 70
CGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHL     71 - 140
MAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNG    141 - 210
FYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN                         211 - 259
//

Text Mined References (237)

PMID Year Title
26714229 2016 Hypoxia Increases IGFBP-1 Phosphorylation Mediated by mTOR Inhibition.
26456333 2015 A Liver-Bone Endocrine Relay by IGFBP1 Promotes Osteoclastogenesis and Mediates FGF21-Induced Bone Resorption.
26245897 2015 Glioblastoma-derived Macrophage Colony-stimulating Factor (MCSF) Induces Microglial Release of Insulin-like Growth Factor-binding Protein 1 (IGFBP1) to Promote Angiogenesis.
26232425 2015 Pregnane X Receptor Represses HNF4? Gene to Induce Insulin-Like Growth Factor-Binding Protein IGFBP1 that Alters Morphology of and Migrates HepG2 Cells.
26118397 2015 Differential effects of low birthweight and intrauterine growth restriction on umbilical cord blood insulin-like growth factor concentrations.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
26025665 2015 Presence of insulin-like growth factor binding proteins correlates with tumor-promoting effects of matrix metalloproteinase 9 in breast cancer.
25957086 2015 IGFBP-1 hyperphosphorylation in response to leucine deprivation is mediated by the AAR pathway.
25890304 2015 Insulin-like growth factors and related proteins in plasma and cerebrospinal fluids of HIV-positive individuals.
25869614 2015 Carnosine decreases IGFBP1 production in db/db mice through suppression of HIF-1.
25757011 2015 HIF-2? attenuates lymphangiogenesis by up-regulating IGFBP1 in hepatocellular carcinoma.
25746666 2015 Complexes between insulin-like growth factor binding proteins and alpha-2-macroglobulin in patients with tumor.
25597167 2014 Predictive value of phosphorylated insulin-like growth factor binding protein-1 (PIGFBP-1) (bedside test) in preterm labor.
25543125 2015 Inhibition of intracerebral glioblastoma growth by targeting the insulin-like growth factor 1 receptor involves different context-dependent mechanisms.
25461385 2014 The metabolic syndrome and ECG detected left ventricular hypertrophy--influences from IGF-1 and IGF-binding protein-1.
25348852 2015 Prediagnostic plasma IGFBP-1, IGF-1 and risk of prostate cancer.
25337205 2014 Insulin-like growth factor binding protein-1 inhibits cancer cell invasion and is associated with poor prognosis in hepatocellular carcinoma.
25123037 2014 IGFBP1 in epithelial circulating tumor cells as a potential response marker to selective internal radiation therapy in hepatocellular carcinoma.
24919336 2014 [The insulin-like growth factor IGFBP-1--specific marker for preterm delivery in pregnant women with clinical symptoms].
24856042 2014 Placental alkaline phosphatase de-phosphorylates insulin-like growth factor (IGF)-binding protein-1.
24612210 2014 Insulin-like growth factor binding protein-1 (Actim PROM test) for detection of premature rupture of fetal membranes.
24513543 2014 Insulin-like growth factor binding protein-related protein 1 and cancer.
24436153 2014 Rapid cervical phIGFBP-1 test in asymptomatic twin pregnancies: role in mid-pregnancy prediction of spontaneous preterm delivery.
24431302 2014 Wnt signaling in midbrain dopaminergic neuron development and regenerative medicine for Parkinson's disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24248464 2014 Importance of C/EBP? binding and histone acetylation status in the promoter regions for induction of IGFBP-1, PRL, and Mn-SOD by cAMP in human endometrial stromal cells.
24132762 2014 Elevated insulin-like growth factor binding protein-1 (IGFBP-1) in men with metastatic prostate cancer starting androgen deprivation therapy (ADT) is associated with shorter time to castration resistance and overall survival.
24056811 2014 Delta insulin-like growth factor binding protein-1 (?IGFBP-1): a marker of hepatic insulin resistance?
23942851 2013 High concentrations of pyridoxal stimulate the expression of IGFBP1 in HepG2 cells through upregulation of the ERK/c?Jun pathway.
23815140 2013 Hypoxia alters phosphorylation status of insulin-like growth factor (IGF)-binding protein-1 and attenuates biological activities of IGF-I in HepG2 cell cultures.
23603247 2013 The PRB-dependent FOXO1/IGFBP-1 axis is essential for progestin to inhibit endometrial epithelial growth.
23585335 2013 Differential expression of serum glycodelin and insulin-like growth factor binding protein 1 in early pregnancy.
23408645 2013 Early pregnancy vaginal fluid phosphorylated insulin-like growth factor binding protein-1 predicts preterm delivery.
23377640 2013 Common genetic variation and antidepressant efficacy in major depressive disorder: a meta-analysis of three genome-wide pharmacogenetic studies.
23354097 2013 Phosphorylation of IGFBP-1 at discrete sites elicits variable effects on IGF-I receptor autophosphorylation.
23190203 2013 Insulin-like growth factor binding protein-1 (IGFBP-1) during normal pregnancy.
23183724 2013 Differential proteolysis of insulin-like growth factor binding protein-1 (IGFBP-1) in pregnancy.
23095194 2013 Clinical evaluation of soluble intercellular adhesion molecule-1 and insulin like growth factor-binding protein-1-based rapid immunoassays for the diagnosis of prelabor rupture of membranes.
22894543 2012 Genetic variability in IGF-1 and IGFBP-3 and body size in early life.
22843786 2012 RTEF-1 attenuates blood glucose levels by regulating insulin-like growth factor binding protein-1 in the endothelium.
22745191 2012 The HMGA1-IGF-I/IGFBP system: a novel pathway for modulating glucose uptake.
22554827 2012 Insulin-like growth factor axis and risk of type 2 diabetes in women.
22442270 2012 Decline in circulating insulin-like growth factors and mortality in older adults: cardiovascular health study all-stars study.
22357965 2012 Increasing circulating IGFBP1 levels improves insulin sensitivity, promotes nitric oxide production, lowers blood pressure, and protects against atherosclerosis.
22325929 2012 Plasma profiling by a protein array approach identifies IGFBP-1 as a novel biomarker of abdominal aortic aneurysm.
22239027 2011 Insulin-like growth factor binding protein-1 and glycodelin levels in uterine flushing before and after hysteroscopic polypectomy.
22187946 2012 Hepatitis C core protein impairs insulin downstream signalling and regulatory role of IGFBP-1 expression.
22113073 2012 Associations of IGF1 and its binding proteins with abdominal aortic aneurysm and aortic diameter in older men.
22104117 2012 The expression of IGFs and IGF binding proteins in human carotid atherosclerosis, and the possible role of IGF binding protein-1 in the regulation of smooth muscle cell proliferation.
22072736 2012 Increased activation of the PI3K/AKT pathway compromises decidualization of stromal cells from endometriosis.
21940708 2012 Role of Rho GTPases in human trophoblast migration induced by IGFBP1.
21933314 2012 Infants of diabetic mothers: echocardiographic measurements and cord blood IGF-I and IGFBP-1.
21930730 2012 Association of insulin and insulin-like growth factors with Barrett's oesophagus.
21892205 2012 Insulin-like growth factor-binding protein-1 (IGFBP-1) regulates human schwannoma proliferation, adhesion and survival.
21852217 2012 Insulin-like growth factor axis gene polymorphisms modify risk of pancreatic cancer.
21741060 2012 Circulating levels of insulin-like growth factor binding protein-1 in relation to insulin resistance, type 2 diabetes mellitus, and metabolic syndrome (Chennai Urban Rural Epidemiology Study 118).
21550830 2011 Neutrophil-derived azurocidin cleaves insulin-like growth factor-binding protein-1, -2 and -4.
21521316 2011 Leptin is better than any other biological parameter for monitoring the efficacy of renutrition in hospitalized malnourished elderly patients.
21457161 2011 IGFBP-1 is expressed specifically in ovarian clear cell adenocarcinoma.
21378090 2011 Associations of IGF1 and IGFBPs 1 and 3 with all-cause and cardiovascular mortality in older men: the Health In Men Study.
21247237 2011 The combination of short cervical length and phIGFBP-1 in the prediction of preterm delivery in symptomatic women.
21212012 2011 Decreased placental expression of hPGH, IGF-I and IGFBP-1 in pregnancies complicated by fetal growth restriction.
21198359 2011 Longitudinal association between IGFBP-1 levels and parameters of the metabolic syndrome in obese children before and after weight loss.
21156761 2011 A genome-wide association study suggests contrasting associations in ACPA-positive versus ACPA-negative rheumatoid arthritis.
21140206 2011 IGFBP1 and IGFBP3 polymorphisms predict circulating IGFBP-3 levels among women from high-risk breast cancer families.
21104586 2011 Association between the pattern of IGFBP-1 alteration and the glucose/insulin metabolic control.
21078522 2011 Common genetic variation within IGFI, IGFII, IGFBP-1, and IGFBP-3 and endometrial cancer risk.
20885978 2010 TGF?1 attenuates expression of prolactin and IGFBP-1 in decidualized endometrial stromal cells by both SMAD-dependent and SMAD-independent pathways.
20884247 Effect of the somatostatin analog octreotide acetate on circulating insulin-like growth factor-1 and related peptides in patients with non-metastatic castration-resistant prostate cancer: results of a phase II study.
20810604 2010 Eighteen insulin-like growth factor pathway genes, circulating levels of IGF-I and its binding protein, and risk of prostate and breast cancer.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20731527 2011 A cross-sectional analysis of the associations between adult height, BMI and serum concentrations of IGF-I and IGFBP-1 -2 and -3 in the European Prospective Investigation into Cancer and Nutrition (EPIC).
20711952 2010 Vitamin D regulates steroidogenesis and insulin-like growth factor binding protein-1 (IGFBP-1) production in human ovarian cells.
20637724 2010 Insulin-like growth factor binding protein-1 levels are increased in patients with IgA nephropathy.
20634197 2010 Comprehensive analysis of common genetic variation in 61 genes related to steroid hormone and insulin-like growth factor-I metabolism and breast cancer risk in the NCI breast and prostate cancer cohort consortium.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20587581 2010 Sleeping during the day: effects on the 24-h patterns of IGF-binding protein 1, insulin, glucose, cortisol, and growth hormone.
20484221 2010 A comprehensive analysis of common IGF1, IGFBP1 and IGFBP3 genetic variation with prospective IGF-I and IGFBP-3 blood levels and prostate cancer risk among Caucasians.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20416304 2010 Insulin-like growth factor axis gene polymorphisms and clinical outcomes in pancreatic cancer.
20413521 2010 Copeptin, IGFBP-1, and cardiovascular prognosis in patients with type 2 diabetes and acute myocardial infarction: a report from the DIGAMI 2 trial.
20155489 2010 Common genetic variation of insulin-like growth factor-binding protein 1 (IGFBP-1), IGFBP-3, and acid labile subunit in relation to serum IGF-I levels and mammographic density.
20149700 2010 Growth hormone receptor d3-variant, insulin-like growth factor binding protein-1 -575G/A polymorphism and postnatal catch-up growth: association with parameters of glucose homeostasis in former extremely low birth weight preterm infants.
20144192 2010 Chromosome 7p linkage and association study for diabetes related traits and type 2 diabetes in an African-American population enriched for nephropathy.
20143870 2010 Site-specific IGFBP-1 hyper-phosphorylation in fetal growth restriction: clinical and functional relevance.
20102313 2010 Urinary excretion of IGFBP-1 and -3 correlates with disease activity and differentiates focal segmental glomerulosclerosis and minimal change disease.
20039319 2010 IGF1, IGFBP1, and IGFBP3 genes and mammographic density: the Multiethnic Cohort.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19917654 2010 IGF1 and its binding proteins 3 and 1 are differentially associated with metabolic syndrome in older men.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19858071 2009 Common genetic variation in IGF1, IGFBP1 and IGFBP3 and ovarian cancer risk.
19843326 2009 Genetic variation in insulin-like growth factor signaling genes and breast cancer risk among BRCA1 and BRCA2 carriers.
19765076 2009 Identification of the amniotic fluid insulin-like growth factor binding protein-1 phosphorylation sites and propensity to proteolysis of the isoforms.
19732896 2010 Serum insulin-like growth factor binding protein-1 (IGFBP-1) phosphorylation status in subjects with and without ischaemic heart disease.
19730683 2009 The variant rs1867277 in FOXE1 gene confers thyroid cancer susceptibility through the recruitment of USF1/USF2 transcription factors.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19551864 2010 Genetic variation and circulating levels of IGF-I and IGFBP-3 in relation to risk of proliferative benign breast disease.
19539506 2009 IGFBP-1 protease activity and IGFBP-1 fragments in a patient with multiple myeloma.
19463807 2009 Biological variation in fasting serum insulin-like growth factor binding protein-1 (IGFBP-1) among individuals with a varying glucose tolerance.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19434535 2009 [Association of insulin, insulin-like growth factor and insulin-like growth factor binding proteins with the risk of colorectal cancer].
19308628 2009 Bone histomorphometry in male idiopathic osteoporosis.
19193607 2009 Functional and complementary phosphorylation state attributes of human insulin-like growth factor-binding protein-1 (IGFBP-1) isoforms resolved by free flow electrophoresis.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19158202 2009 Insulin-like growth factor-binding protein-1: serum levels, promoter polymorphism, and associations with components of the metabolic syndrome in short subjects born small for gestational age.
19124510 2009 Insulin-like growth factor-1- and interleukin-6-related gene variation and risk of multiple myeloma.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
18924579 2008 Insulin-like growth factor-I is inversely related to adiposity in overweight Latino children.
18828733 2008 Anthropometry, carbohydrate and lipid metabolism in the East Flanders Prospective Twin Survey: linkage of candidate genes using two sib-pair based variance components analyses.
18793810 2010 Insulin-like growth factor binding protein-1 is a long-term predictor of heart failure in survivors of a first acute myocardial infarction and population controls.
18772238 2009 Hypoxia and leucine deprivation induce human insulin-like growth factor binding protein-1 hyperphosphorylation and increase its biological activity.
18701096 2008 Tumor suppressor gene insulin-like growth factor binding protein-related protein 1 (IGFBP-rP1) induces senescence-like growth arrest in colorectal cancer cells.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18665784 2008 IGF-1 and IGF-binding proteins and bone mass, geometry, and strength: relation to metabolic control in adolescent girls with type 1 diabetes.
18636124 2008 Polymorphisms in the estrogen receptor 1 and vitamin C and matrix metalloproteinase gene families are associated with susceptibility to lymphoma.
18596909 2008 IGF-1, IGFBP-1, and IGFBP-3 polymorphisms predict circulating IGF levels but not breast cancer risk: findings from the Breast and Prostate Cancer Cohort Consortium (BPC3).
18513511 2008 High insulinlike growth factor binding protein 1 level predicts incident congestive heart failure in the elderly.
18496669 2008 Insulin-like growth factor-binding protein-1 in the prediction and development of type 2 diabetes in middle-aged Swedish men.
18305566 2008 Rescue of migratory defects of Ehlers-Danlos syndrome fibroblasts in vitro by type V collagen but not insulin-like binding protein-1.
18259111 2008 Temporal changes in insulin-like growth factors I and II and in insulin-like growth factor binding proteins 1, 2, and 3 in human milk.
18166823 2008 Changes in circulating level of IGF-I and IGF-binding protein-1 from the first to second trimester as predictors of preeclampsia.
17972510 Evidence for a tumour suppressive function of IGF1-binding proteins in human breast cancer.
17972051 2007 Association of gastric cancer with tyrosine hydroxylase gene polymorphism in a northwestern Chinese population.
17914103 2007 Insulin pathway related genes and risk of colorectal cancer: INSR promoter polymorphism shows a protective effect.
17890489 2007 Relationship of plasma adiponectin with sex hormone and insulin-like growth factor levels.
17803702 2008 Correlation of serum IGF-I and IGFBP-1 and -3 to cardiovascular risk indicators and early carotid atherosclerosis in healthy middle-aged men.
17655506 2007 Calpain proteolysis of insulin-like growth factor binding protein (IGFBP) -2 and -3, but not of IGFBP-1.
17640761 2007 Stabilization of IGFBP-1 mRNA by ethanol in hepatoma cells involves the JNK pathway.
17634530 2007 Epigenetic inactivation implies independent functions for insulin-like growth factor binding protein (IGFBP)-related protein 1 and the related IGFBPL1 in inhibiting breast cancer phenotypes.
17566087 2007 Genetic determinants of circulating insulin-like growth factor (IGF)-I, IGF binding protein (BP)-1, and IGFBP-3 levels in a multiethnic population.
17485842 2007 Cadmium cation increases the production and mRNA levels of insulin-like growth factor-binding protein-1 in HepG2.
17465992 2007 Strong suppression of tumor growth by insulin-like growth factor-binding protein-related protein 1/tumor-derived cell adhesion factor/mac25.
17341623 2006 The cAMP-responsive unit of the human insulin-like growth factor-binding protein-1 coinstitutes a functional insulin-response element.
17300730 2007 Common genetic variation in IGF1, IGFBP-1, and IGFBP-3 in relation to mammographic density: a cross-sectional study.
17264182 2007 Association of total insulin-like growth factor-I, insulin-like growth factor binding protein-1 (IGFBP-1), and IGFBP-3 levels with incident coronary events and ischemic stroke.
17164371 2006 Prostate cancer risk in relation to selected genetic polymorphisms in insulin-like growth factor-I, insulin-like growth factor binding protein-3, and insulin-like growth factor-I receptor.
17113753 2007 Serum levels of insulin-like growth factors (IGFs) and their binding proteins (IGFBPs), -1, -2, -3, in oral cancer.
17062566 2006 The insulin-like growth factor-binding protein 1 gene is a primary target of peroxisome proliferator-activated receptors.
17035411 2006 Haplotype-based association studies of IGFBP1 and IGFBP3 with prostate and breast cancer risk: the multiethnic cohort.
16973813 2007 Exercise-dependent IGF-I, IGFBPs, and type I collagen changes in human peritendinous connective tissue determined by microdialysis.
16924115 2006 Structural basis for the inhibition of insulin-like growth factors by insulin-like growth factor-binding proteins.
16868142 2006 Changes in bioactive IGF-I and IGF-binding protein-1 during an oral glucose tolerance test in patients with liver cirrhosis.
16809446 2006 Insulin-like growth factor binding protein (IGFBP-1) involvement in intrauterine growth retardation: study on IGFBP-1 overexpressing transgenic mice.
16776662 2006 Gender differences in the insulin-like growth factor axis response to a glucose load.
16687408 2006 Endoplasmic reticulum stress induction of insulin-like growth factor-binding protein-1 involves ATF4.
16404426 2006 Polymorphisms of genes coding for insulin-like growth factor 1 and its major binding proteins, circulating levels of IGF-I and IGFBP-3 and breast cancer risk: results from the EPIC study.
16338475 IGFBP1 and Follistatin-like 3 genes are significantly up-regulated in expression profiles of the IUGR placenta.
16337840 2006 Elevated IGFBP-1 cause high bone turnover in growth-restricted monochorionic twins with discordant birth weight.
16306374 2005 Polymorphisms in IGF-binding protein 1 are associated with impaired renal function in type 2 diabetes.
16293667 2006 Elevated circulating insulin-like growth factor binding protein-1 is sufficient to cause fetal growth restriction.
16222695 2005 Differential expression of insulin-like growth factor binding protein 1 and ferritin light polypeptide in gestational trophoblastic neoplasia: combined cDNA suppression subtractive hybridization and microarray study.
16118248 2006 Mechanical stretch upregulates IGFBP-1 secretion from decidualized endometrial stromal cells.
16041536 2005 Marked differences in the IGF system that are associated with migration in comparable populations of Gujaratis living in Sandwell, UK, and Gujarat, India.
16002526 2005 Insulin response sequence-dependent and -independent mechanisms mediate effects of insulin on glucocorticoid-stimulated insulin-like growth factor binding protein-1 promoter activity.
15987847 2005 Insulin-like growth factor II and binding proteins 1 and 3 from second trimester human amniotic fluid are associated with infant birth weight.
15987820 2005 Role of FOXO1A in the regulation of insulin-like growth factor-binding protein-1 in human endometrial cells: interaction with progesterone receptor.
15972819 2005 Structure and properties of the C-terminal domain of insulin-like growth factor-binding protein-1 isolated from human amniotic fluid.
15959422 2005 Cord serum insulin-like growth factor binding protein-1 and -3: effect of maternal diabetes and relationships to fetal growth.
15890677 2005 The coactivator p300 directly acetylates the forkhead transcription factor Foxo1 and stimulates Foxo1-induced transcription.
15797461 2005 Insulin-like growth factor signaling in fish.
15736102 2005 Altered response of insulin-like growth factor-binding protein 1 to nutritional deprivation in type 2 diabetes mellitus.
15613433 2005 Dose-dependent insulin regulation of insulin-like growth factor binding protein-1 in human endometrial stromal cells is mediated by distinct signaling pathways.
15598684 2005 Insulin-like growth factor binding protein-1 is independently affected by ethnicity, insulin sensitivity, and leptin in healthy, glucose-tolerant young men.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15166120 2004 Administration of human insulin-like growth factor-binding protein-1 increases circulating levels of growth hormone in mice.
15070959 2004 Metabolic, anthropometric, and nutritional factors as predictors of circulating insulin-like growth factor binding protein-1 levels in middle-aged and elderly men.
15070833 2004 Matrix metalloprotease-3 and -9 proteolyze insulin-like growth factor-binding protein-1.
14764802 2004 Reduced serum glycodelin and insulin-like growth factor-binding protein-1 in women with polycystic ovary syndrome during first trimester of pregnancy.
14726451 2004 Reproductive abnormalities in human insulin-like growth factor-binding protein-1 transgenic male mice.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
14715837 2004 The prospective association of serum insulin-like growth factor I (IGF-I) and IGF-binding protein-1 levels with all cause and cardiovascular disease mortality in older adults: the Rancho Bernardo Study.
14624764 2003 Elevated insulin, proinsulin and insulin-like growth factor-binding protein-1 in liver disease.
14568572 2003 Comparative studies on the regulation of insulin-like growth factor-binding protein-1 (IGFBP-1) and sex hormone-binding globulin (SHBG) production by insulin and insulin-like growth factors in human hepatoma cells.
12933666 2003 Acute in vivo elevation of insulin-like growth factor (IGF) binding protein-1 decreases plasma free IGF-I and muscle protein synthesis.
12882925 2003 Vascular endothelial function and blood pressure homeostasis in mice overexpressing IGF binding protein-1.
12870155 2003 Serum levels of insulin-like growth factor-I (IGF-I), and IGF-binding proteins-1 and -3 in middle-aged and young athletes versus sedentary men: relationship with glucose disposal.
12861174 2003 Longitudinal analysis of serum insulin-like growth factor-I and insulin-like growth factor binding protein-1 in antiphospholipid syndrome and in healthy pregnancy.
12853948 2003 The DNA sequence of human chromosome 7.
12843192 2003 The role of mitogen-activated protein kinase in insulin and insulin-like growth factor I (IGF-I) signaling cascades for progesterone and IGF-binding protein-1 production in human granulosa cells.
12843178 2003 The effect of growth hormone on the insulin-like growth factor system during fasting.
12746836 2003 Insulin-like growth factor binding protein-related protein 1 (IGFBP-rP1/mac 25) is reduced in human prostate cancer and is inversely related to tumor volume and proliferation index in Lucap 23.12 xenografts.
12746292 2003 Insulin-like growth factor I (IGF-I) and IGF binding protein-1 modulate prostate cancer cell growth and apoptosis: possible mediators for the effects of diet and exercise on cancer cell survival.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12679458 2003 The relationship among circulating insulin-like growth factor (IGF)-I, IGF-binding proteins-1 and -2, and birth anthropometry: a prospective study.
12571183 2003 Insulin-like growth factor (IGF)-1 and IGF binding protein-1 and -3 in the follicular fluid of infertile patients with endometriosis.
12556485 2003 Impaired hepatocyte DNA synthetic response posthepatectomy in insulin-like growth factor binding protein 1-deficient mice with defects in C/EBP beta and mitogen-activated protein kinase/extracellular signal-regulated kinase regulation.
12519841 2003 Free and total insulin-like growth factor (IGF)-I, -II, and IGF binding protein-1, -2, and -3 serum levels in patients with active thyroid eye disease.
12493691 2003 Regulation of insulin-like growth factor binding protein-1 promoter activity by FKHR and HOXA10 in primate endometrial cells.
12489207 2002 Bone formation in the context of growth retardation induced by hIGFBP-1 overexpression in transgenic mice.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12466191 2002 Cellular actions of the insulin-like growth factor binding proteins.
12351482 2002 Reduced IGFBP-1 is associated with thickening of the carotid wall in type 2 diabetes.
12163461 2002 Altered placental development and intrauterine growth restriction in IGF binding protein-1 transgenic mice.
12153746 2002 Lack of physiological suppression of circulating IGFBP-1 in puberty in patients with insulin-dependent diabetes mellitus.
12150454 2002 Insulin-like growth factor binding proteins 1 and 3 and breast cancer outcomes.
12135130 2002 Circulating levels of insulin-like growth factor-1 and its binding proteins in patients with hypertrophic cardiomyopathy.
12119297 2002 Peptide substrate specificities and protein cleavage sites of human endometase/matrilysin-2/matrix metalloproteinase-26.
12082253 2002 Insulin-like growth factor-binding protein 1 and blood rheology in athletes.
12006706 2002 Insulin-like growth factors and insulin-like growth factor binding proteins in adult patients with severe liver disease before and after orthotopic liver transplantation.
11969341 2002 The regional expression of insulin-like growth factor II (IGF-II) and insulin-like growth factor binding protein-1 (IGFBP-1) in the placentae of women with pre-eclampsia.
11834727 2002 Increases in free, unbound insulin-like growth factor I enhance insulin responsiveness in human hepatoma G2 cells in culture.
11793026 2001 Insulin-like growth factor 2 (IGF2 ) and IGF-binding protein 1 (IGFBP1) gene variants are associated with overfeeding-induced metabolic changes.
11762714 2001 Serum insulin-like growth factor type 1, insulin-like growth factor-binding protein-1, and insulin-like growth factor-binding protein-3 concentrations in patients with thyroid dysfunction.
11752456 2001 Insight into hepatocellular carcinogenesis at transcriptome level by comparing gene expression profiles of hepatocellular carcinoma with those of corresponding noncancerous liver.
11397868 2001 Hypoxia regulates insulin-like growth factor-binding protein 1 in human fetal hepatocytes in primary culture: suggestive molecular mechanisms for in utero fetal growth restriction caused by uteroplacental insufficiency.
11297622 2001 Transferrin is an insulin-like growth factor-binding protein-3 binding protein.
11050672 2000 Cycle modulation of insulin-like growth factor-binding protein 1 in human endometrium.
10987657 1999 Duplication of 7p12.1-p13, including GRB10 and IGFBP1, in a mother and daughter with features of Silver-Russell syndrome.
10965886 2000 Stimulation of insulin-like growth factor binding protein-1 synthesis by interleukin-1beta: requirement of the mitogen-activated protein kinase pathway.
10810289 2000 Binding characteristics of pro-insulin-like growth factor-II from cancer patients: binary and ternary complex formation with IGF binding proteins-1 to -6.
10691413 2000 Biallelic expression of IGFBP1 and IGFBP3, two candidate genes for the Silver-Russell syndrome.
10364674 1999 Screening for mutations in the promoter and the coding region of the IGFBP1 and IGFBP3 genes in Silver-Russell syndrome patients.
10352394 1999 Insulin-like growth factor binding proteins: new proteins, new functions.
10350456 1999 Total alanine-scanning mutagenesis of insulin-like growth factor I (IGF-I) identifies differential binding epitopes for IGFBP-1 and IGFBP-3.
10329650 1999 The N-terminal disulfide linkages of human insulin-like growth factor-binding protein-6 (hIGFBP-6) and hIGFBP-1 are different as determined by mass spectrometry.
9408744 1997 Insulin-like growth factor-binding proteins in serum and other biological fluids: regulation and functions.
8754754 1996 Insulin-like growth factor-binding protein-1 expression in cultured human bone cells: regulation by insulin and glucocorticoid.
7694877 1993 Sequential appearance of relaxin, prolactin and IGFBP-1 during growth and differentiation of the human endometrium.
7683525 1993 Human IGFBP-1 is phosphorylated on 3 serine residues: effects of site-directed mutagenesis of the major phosphoserine.
7683522 1993 Structure and chromosomal localization of human insulin-like growth factor-binding protein genes.
7678248 1993 Identification of the sites of phosphorylation in insulin-like growth factor binding protein-1. Regulation of its affinity by phosphorylation of serine 101.
7504269 1993 Insulin-like growth factor binding protein 1 stimulates cell migration and binds to the alpha 5 beta 1 integrin by means of its Arg-Gly-Asp sequence.
3419931 1988 Cloning of cDNA encoding human placental protein 12 (PP12): binding protein for IGF I and somatomedin.
2971653 1988 Purification of a 31,000-dalton insulin-like growth factor binding protein from human amniotic fluid. Isolation of two forms with different biologic actions.
2849945 1988 Organization of the gene encoding the insulin-like growth factor binding protein IBP-1.
2478445 1989 The gene encoding human low-molecular weight insulin-like growth-factor binding protein (IGF-BP25): regional localization to 7p12-p13 and description of a DNA polymorphism.
2474129 1989 Structure of the human chromosomal gene for the 25 kilodalton insulin-like growth factor binding protein.
2466665 1989 Human insulin-like growth-factor-binding protein. Low-molecular-mass form: protein sequence and cDNA cloning.
2461294 1988 Isolation and characterization of a cDNA encoding the low molecular weight insulin-like growth factor binding protein (IBP-1).
2458522 1988 Insulin-like growth factor (IGF) binding protein complementary deoxyribonucleic acid from human HEP G2 hepatoma cells: predicted protein sequence suggests an IGF binding domain different from those of the IGF-I and IGF-II receptors.
2457513 1988 Primary structure of human insulin-like growth factor-binding protein/placental protein 12 and tissue-specific expression of its mRNA.
2454104 1988 Cloning, characterization, and expression of a human insulin-like growth factor binding protein.
1718783 1991 Site-directed mutagenesis of the N-terminal region of IGF binding protein 1; analysis of IGF binding capability.
1701175 1990 The promoter of the human gene for insulin-like growth factor binding protein-1. Basal promoter activity in HEP G2 cells depends upon liver factor B1.
1691735 1990 The gene for insulin-like growth factor-binding protein-1 is localized to human chromosomal region 7p14-p12.
1373120 1992 Contiguous localization of the genes encoding human insulin-like growth factor binding proteins 1 (IGBP1) and 3 (IGBP3) on chromosome 7.