Property Summary

NCBI Gene PubMed Count 129
PubMed Score 164.82
PubTator Score 100.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
adult high grade glioma 2.500 1.6e-04
astrocytoma 1.100 2.1e-04
Astrocytoma, Pilocytic 1.700 1.7e-02
atypical teratoid / rhabdoid tumor 3.300 8.6e-04
colon cancer 2.400 3.2e-02
cutaneous lupus erythematosus 2.000 2.4e-03
ependymoma 1.700 4.4e-03
esophageal adenocarcinoma 1.500 4.1e-02
gastric cancer 1.600 1.1e-03
glioblastoma 3.000 1.1e-06
group 3 medulloblastoma 4.300 1.4e-04
intraductal papillary-mucinous neoplasm ... 4.300 4.9e-03
lung adenocarcinoma 1.100 4.2e-05
lung cancer -1.200 2.6e-02
medulloblastoma, large-cell 4.600 4.3e-07
nasopharyngeal carcinoma 1.900 1.6e-02
non-small cell lung cancer 3.664 6.5e-20
oligodendroglioma 1.100 1.8e-03
osteosarcoma 2.514 3.0e-05
ovarian cancer 2.200 3.5e-03
pancreatic cancer 1.900 2.5e-04
pancreatic carcinoma 1.900 2.5e-04
primitive neuroectodermal tumor 3.500 2.6e-03
Rheumatoid arthritis 1.300 3.6e-02
tuberculosis 1.700 8.7e-05

Gene RIF (108)

AA Sequence

MNKLYIGNLSENAAPSDLESIFKDAKIPVSGPFLVKTGYAFVDCPDESWALKAIEALSGKIELHGKPIEV      1 - 70
EHSVPKRQRIRKLQIRNIPPHLQWEVLDSLLVQYGVVESCEQVNTDSETAVVNVTYSSKDQARQALDKLN     71 - 140
GFQLENFTLKVAYIPDEMAAQQNPLQQPRGRRGLGQRGSSRQGSPGSVSKQKPCDLPLRLLVPTQFVGAI    141 - 210
IGKEGATIRNITKQTQSKIDVHRKENAGAAEKSITILSTPEGTSAACKSILEIMHKEAQDIKFTEEIPLK    211 - 280
ILAHNNFVGRLIGKEGRNLKKIEQDTDTKITISPLQELTLYNPERTITVKGNVETCAKAEEEIMKKIRES    281 - 350
YENDIASMNLQAHLIPGLNLNALGLFPPTSGMPPPTSGPPSAMTPPYPQFEQSETETVHLFIPALSVGAI    351 - 420
IGKQGQHIKQLSRFAGASIKIAPAEAPDAKVRMVIITGPPEAQFKAQGRIYGKIKEENFVSPKEEVKLEA    421 - 490
HIRVPSFAAGRVIGKGGKTVNELQNLSSAEVVVPRDQTPDENDQVVVKITGHFYACQVAQRKIQEILTQV    491 - 560
KQHQQQKALQSGPPQSRRK                                                       561 - 579
//

Text Mined References (140)

PMID Year Title