Property Summary

NCBI Gene PubMed Count 143
PubMed Score 54.63
PubTator Score 81.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
Barrett's esophagus 1.600 9.2e-03
esophageal adenocarcinoma 2.100 1.8e-02
psoriasis -1.500 8.1e-04
glioblastoma 2.000 1.1e-02
osteosarcoma -1.807 2.2e-02
atypical teratoid / rhabdoid tumor 2.000 1.8e-03
primitive neuroectodermal tumor 2.100 2.7e-02
pancreatic ductal adenocarcinoma liver m... 2.688 1.5e-03
non-small cell lung cancer 1.468 2.6e-08
intraductal papillary-mucinous adenoma (... 1.300 5.1e-03
intraductal papillary-mucinous neoplasm ... 1.900 2.9e-03
lung cancer -2.300 7.9e-04
pancreatic cancer 1.200 3.0e-05
pediatric high grade glioma 1.300 5.7e-03
group 3 medulloblastoma -1.200 2.9e-02
pilocytic astrocytoma 2.000 9.2e-06
posterior fossa group A ependymoma 1.200 2.2e-03
lung carcinoma -1.900 6.3e-27
spina bifida -1.792 3.7e-02
Breast cancer -1.700 3.0e-08

Protein-protein Interaction (8)

Gene RIF (132)

PMID Text
26889980 IMP2 expression is higher in ovarian and endometrial high-grade serous carcinomas (HGSC) than in ovarian or endometrial endometrioid carcinoma. Knockdown in ovarian HGSC cell line decreased cell proliferation.
26416451 p62/IMP2 stimulates cell migration and reduces cell adhesion, contributing to breast cancer progression.
26160756 Data show that insulin-like growth factor-2-mRNA-binding proteins IGF2BP1, IGF2BP2, and IGF2BP3 are direct targets of microRNA-1275 (miR-1275).
26115082 Our results suggest IGF2BP2 and KCNQ1 polymorphisms might be independent predictors of chemotherapeutic response
26107517 HPV16 Down-Regulates the Insulin-Like Growth Factor Binding Protein 2 to Promote Epithelial Invasion
25721883 Data suggest that autoantibody against IGF2 mRNA-Binding Protein 2 (IMP2/p62) may be a useful serum biomarker for early-stage breast cancer screening and diagnosis.
25719943 Imp2 regulates the activity of IGF2, which further activates PI3K/Akt signaling.
25661373 The IGF2BP2 gene rs4402960 polymorphism increases the breast cancer risk of Chinese females with Han nationality, and is a breast cancer predisposing gene.
25247335 The IGF2BP2 gene rs1470579 and rs4402960 polymorphisms were associated with type 2 diabetes patients and therapeutic efficacy of pioglitazone in this Chinese population
25062844 The present study provided data suggesting that the wild C allele of IGF2BP2 (rs4402960) had a protective effect against T2DM in obese subjects of Chinese Han population.
25010285 Interaction of HIV-1 Gag with insulin-like growth factor 2 mRNA binding protein 2 (IGF2BP2) is identified in a series of six affinity purification/mass spectrometry screens
24898818 The case-control study and meta-analysis revealed a significant association between the IGF2BP2 rs4402960 variant and type 2 diabetes in Moroccan and Arab populations.[meta-analysis]
24814803 VICKZ1 and VICKZ2 are overexpressed in ovarian carcinoma effusions suggesting a biological role at this anatomical site, and appear to have a role in proteolysis and invasion. VICKZ2 may be a prognostic marker in ovarian serous carcinoma effusions.
24636221 rs4402960 of IGF2BP2 gene is a strong candidate for Type 2 diabetes susceptibility and overweight/obesity risk.
24229666 IGF2BP2 was strongly associated with the risk of T2DM in Chinese Han population.
23670970 TCF7L2 was replicated in this study (P = 0.004; combined analysis P = 3.8 x 10(-6)), and type 2 diabetes SNPs at or near CDKAL1, CDKN2A/B, and IGF2BP2 were associated with CFRD
23656854 IGF2BP2 may play a role in susceptibility to schizophrenia in Han Chinese, supporting the hypothesis that the co-occurrence of type 2 diabetes mellitus and schizophrenia may be explained by shared genetic risk variants.
23536553 findings implicate the HMGA2-IGFBP2-NRAS signaling pathway as a critical oncogenic driver in embryonic rhabdomyosarcoma
23421499 there is a strong immune response of anti-p62 in sera from patients with colon cancer compared with normal human sera (NHS).
23418049 Our results revealed two novel genes (IGF2BP2 and TNFRSF13B), whose function could account for the biologic pathways influencing MetS phenotypes.
23403707 IGF2BP2 genetic variants contribute to insulin resistance in Russian NIDDM patients.
23364967 Polymorphisms in PPARgamma(2) and IGF2BP2 were shown to be highly correlated with GDM occurrence, whereas no correlation was found for KCNQ1 polymorphisms.
23257922 p62 exerts IGF2-independent antiapoptotic action, which is facilitated via phosphorylation of ERK1/2.
23144361 In African Americans, seven of the 29 SNPs examined were found to be associated with T2D risk at P </= 0.05, including rs6769511 (IGF2BP2).
23029108 IGF2BP2 alternative variants were associated with GADA negative diabetes. The IGF2BP2 haplotypes and diplotypes increased the risk of diabetes in Malaysian subject.
22923468 Association to type 2 diabetes was found for rs13266634 (SLC30A8), rs7923837 (HHEX), rs10811661 (CDKN2A/2B), rs4402960 (IGF2BP2), rs12779790 (CDC123/CAMK1D), and rs2237892 (KCNQ1).
22899010 oncofetal insulin-like growth factor 2 mRNA-binding protein 2 (IMP2, IGF2BP2) regulates oxidative phosphorylation (OXPHOS) in primary glioblastoma (GBM) sphere cultures (gliomaspheres)
22770937 genetic association studies: Data suggest that an SNP in IGF2BP2 (rs4402960) is associated with type 2 diabetes; IGF2BP2 may have genetic interactions with insulin-like growth factor II with a protective effect in male patients with type 1 diabetes.
22427968 Two isoforms of the mRNA binding protein IGF2BP2 are generated by alternative translational initiation.
22245690 Data validate that IGF2BP2 susceptibility variants rs4402960 and rs1470579 associate with T2DM in Lebanese Arabs.
22096510 Six SNP(rs7754840 in CDKAL1, rs391300 in SRR, rs2383208 in CDKN2A/2B, rs4402960 in IGF2BP2, rs10830963 in MTNR1B, rs4607517 in GCK)risk alleles of type 2 diabetes were associated with GDM in pregnant Chinese women.
22032244 IGF2BP2 genetic variation is associated with type 2 diabetes.
22015911 rs4402960 and rs1470579 lymorphisms of the IFG2BP2po is a risk factor for developing type 2 diabetes.
21839790 meta-analysis suggested that IGF2BP2 rs4402960 polymorphism conferred elevated risk of T2DM, especially in European, East Asian and South Asian populations
21771882 involved in the selective autophagic clearance of non-ubiquitylated aggregation-prone substrates
21576258 Double phosphorylation promotes IMP2 binding to the IGF2 leader 3 mRNA 5' untranslated region, and the translational initiation of this mRNA
21422097 IGF2 is emerging as an important gene for ovarian cancer.
21145819 The induction of a steatotic phenotype implies that p62 plays a role in hepatic pathophysiology
20956565 Data reveal how the posttranscriptional regulation of gene expression by IMP-2 contributes to the control of adhesion structures and stable microtubules and demonstrate an important function for IMP-2 in cellular motility.
20929593 Observational study of gene-disease association. (HuGE Navigator)
20889853 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20879858 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20816152 Observational study of gene-disease association. (HuGE Navigator)
20802253 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20712903 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20627640 non-replications of IGF2BP2 associations with type 2 diabetes
20627640 Observational study of gene-disease association. (HuGE Navigator)
20616309 Observational study of gene-disease association. (HuGE Navigator)
20580033 Observational study of gene-disease association. (HuGE Navigator)
20550665 Observational study of gene-disease association. (HuGE Navigator)
20523342 findings show that IGF2BP2 rs1470579 and rs4402960 polymorphisms may be associated with the development of type 2 diabetes and these polymorphisms may affect the therapeutic efficacy of repaglinide in Chinese T2DM patientsmellitus
20523342 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20509872 Observational study of gene-disease association. (HuGE Navigator)
20490451 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20424228 Observational study of gene-disease association. (HuGE Navigator)
20384434 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20215779 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20203524 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20161779 Observational study of gene-disease association. (HuGE Navigator)
20142250 prostate cancer was inversely associated with the IGF2BP2 rs4402960 T allele
20075150 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
20043145 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19933996 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19892838 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19862325 Observational study of gene-disease association. (HuGE Navigator)
19808892 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19794065 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19741467 Observational study of gene-disease association. (HuGE Navigator)
19741166 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19726068 Interaction of HIV-1 Gag with insulin-like growth factor 2 mRNA binding protein 2 (IGF2BP2) is identified in a series of six affinity purification/mass spectrometry screens
19720844 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19602701 Meta-analysis and HuGE review of gene-disease association. (HuGE Navigator)
19592620 Observational study of gene-disease association. (HuGE Navigator)
19502414 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19401414 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19279076 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19258437 The IGF2BP2 variant shows a nominal interaction with exposure to famine in wartime in utero and predisposition to type 2 diabetes.
19258437 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19258404 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19247372 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19228808 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19225753 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19148120 IGF2BP2 single-nucleotide polymorphisms are associated with body fat and this effect on body fat influences insulin resistance which may contribute to type 2 diabetes mellitus risk.
19148120 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19139842 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19082521 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19033397 Type 2 diabetes susceptibility of IGF2BP2 was confirmed in Japanese.
19033397 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19020324 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19020323 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19018773 IGF2BP2 stimulation increases radiosensitivity of a pancreatic cancer cell line through endoplasmic reticulum stress under hypoxic comditions.
19008344 Data show that SNPs in IGF2BP2 did not confer a significant risk for type 2 diabetes in Pima Indians.
19008344 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19002430 Observational study of gene-disease association. (HuGE Navigator)
18991055 Observational study of gene-disease association. (HuGE Navigator)
18984664 Observational study of gene-disease association. (HuGE Navigator)
18853134 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18719881 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18694974 Study show that polymorphisms in IGF2BP2 were associated with type 2 diabetes risk in the studied population.
18633108 The results indicate that in Chinese Hans, common variants in IGF2BP2 loci independently or additively contribute to type 2 diabetes risk, likely mediated through beta-cell dysfunction.
18633108 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18618095 Variants of CDKAL1 and IGF2BP2 attenuate the first phase of glucose-stimulated insulin secretion but show no effect on the second phase of insulin secretion in hyperglycmia and type 2 diabetes.
18618095 Observational study of gene-disease association. (HuGE Navigator)
18598350 IGF2BP2 SNPs revealed a significant association with type 2 diabetes
18598350 Observational study of gene-disease association. (HuGE Navigator)
18597214 Gene variants of CDKAL1, PPARG, IGF2BP2, HHEX, TCF7L2, and FTO predispose to type 2 diabetes in the German KORA 500 K study population.
18597214 Observational study of gene-disease association. (HuGE Navigator)
18591388 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18544707 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18516622 Observational study of gene-disease association. (HuGE Navigator)
18477659 Observational study of gene-disease association. (HuGE Navigator)
18469204 Data confirmed the associations of single nucleotide polymorphisms in IGF2BP2 with risk for type 2 diabetes in Asians.
18469204 Observational study of gene-disease association. (HuGE Navigator)
18443202 Little evidence of association was observed between SNPs in IGF2BP2 and type 2 diabetes in African Americans.
18430866 Novel evidence for a rare variant in the 3' downstream region of IGF2BP2 in type 2 diabetes in French Caucasians.
18430866 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18426861 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18259684 Observational study of gene-disease association. (HuGE Navigator)
18162508 The association of 6 loci with type 2 diabetes risk in Japanese patients is reported.
18162508 Observational study of gene-disease association. (HuGE Navigator)
17928989 Observational study of gene-disease association. (HuGE Navigator)
17827400 Observational study of gene-disease association. (HuGE Navigator)
17804762 Observational study of gene-disease association. (HuGE Navigator)
17463249 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
17463248 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17463246 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17426251 we provide evidence that there is a strong and statistically significant correlation between HMGA2 and IMP2 gene expression in human liposarcomas.
17296566 VICKZ exhibits differential expression in lymphoma subtypes and thus may be a marker of potential value in the diagnosis and study of hematopoietic neoplasia.
15618018 Study suggests that there is a significant association between expression of IMP-2 and the growth of tumor cells, in which IMP-2 is associated with apoptosis induced by tretinoin.
15225648 HMGA2 differentially regulates expression of IMP family members during mouse embryogenesis.

AA Sequence

MMNKLYIGNLSPAVTADDLRQLFGDRKLPLAGQVLLKSGYAFVDYPDQNWAIRAIETLSGKVELHGKIME      1 - 70
VDYSVSKKLRSRKIQIRNIPPHLQWEVLDGLLAQYGTVENVEQVNTDTETAVVNVTYATREEAKIAMEKL     71 - 140
SGHQFENYSFKISYIPDEEVSSPSPPQRAQRGDHSSREQGHAPGGTSQARQIDFPLRILVPTQFVGAIIG    141 - 210
KEGLTIKNITKQTQSRVDIHRKENSGAAEKPVTIHATPEGTSEACRMILEIMQKEADETKLAEEIPLKIL    211 - 280
AHNGLVGRLIGKEGRNLKKIEHETGTKITISSLQDLSIYNPERTITVKGTVEACASAEIEIMKKLREAFE    281 - 350
NDMLAVNQQANLIPGLNLSALGIFSTGLSVLSPPAGPRGAPPAAPYHPFTTHSGYFSSLYPHHQFGPFPH    351 - 420
HHSYPEQEIVNLFIPTQAVGAIIGKKGAHIKQLARFAGASIKIAPAEGPDVSERMVIITGPPEAQFKAQG    421 - 490
RIFGKLKEENFFNPKEEVKLEAHIRVPSSTAGRVIGKGGKTVNELQNLTSAEVIVPRDQTPDENEEVIVR    491 - 560
IIGHFFASQTAQRKIREIVQQVKQQEQKYPQGVASQRSK                                   561 - 599
//

Text Mined References (153)

PMID Year Title
26889980 2016 Similar protein expression profiles of ovarian and endometrial high-grade serous carcinomas.
26416451 2015 p62/IMP2 stimulates cell migration and reduces cell adhesion in breast cancer.
26160756 2015 miR-1275: A single microRNA that targets the three IGF2-mRNA-binding proteins hindering tumor growth in hepatocellular carcinoma.
26115082 2015 Effects of IGF2BP2, KCNQ1 and GCKR polymorphisms on clinical outcome in metastatic gastric cancer treated with EOF regimen.
26107517 2015 HPV16 Down-Regulates the Insulin-Like Growth Factor Binding Protein 2 to Promote Epithelial Invasion in Organotypic Cultures.
25721883 2015 Autoimmune Response to IGF2 mRNA-Binding Protein 2 (IMP2/p62) in Breast Cancer.
25719943 2015 Imp2 regulates GBM progression by activating IGF2/PI3K/Akt pathway.
25661373 2015 Correlation between IGF2BP2 gene polymorphism and the risk of breast cancer in Chinese Han women.
25247335 2014 The effect of IGF2BP2 gene polymorphisms on pioglitazone response in Chinese type 2 diabetes patients.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25062844 2014 IGF2BP2 and obesity interaction analysis for type 2 diabetes mellitus in Chinese Han population.
24898818 2014 Association analysis of IGF2BP2, KCNJ11, and CDKAL1 polymorphisms with type 2 diabetes mellitus in a Moroccan population: a case-control study and meta-analysis.
24814803 2014 VICKZ2 protein expression in ovarian serous carcinoma effusions is associated with poor survival.
24636221 2015 Contribution of CDKAL1 rs7756992 and IGF2BP2 rs4402960 polymorphisms in type 2 diabetes, diabetic complications, obesity risk and hypertension in the Tunisian population.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
24229666 2013 Replication of association study between type 2 diabetes mellitus and IGF2BP2 in Han Chinese population.
23945395 2014 Genome-wide association study identifies three novel loci for type 2 diabetes.
23670970 2013 Genetic modifiers of cystic fibrosis-related diabetes.
23656854 2013 The type 2 diabetes mellitus susceptibility gene IGF2BP2 is associated with schizophrenia in a Han Chinese population.
23640942 2013 Subcellular localization and RNP formation of IGF2BPs (IGF2 mRNA-binding proteins) is modulated by distinct RNA-binding domains.
23536553 2013 Oncogenic NRAS, required for pathogenesis of embryonic rhabdomyosarcoma, relies upon the HMGA2-IGF2BP2 pathway.
23421499 2013 Humoral autoimmune response to IGF2 mRNA-binding protein (IMP2/p62) and its tissue-specific expression in colon cancer.
23418049 2013 QTL-based association analyses reveal novel genes influencing pleiotropy of metabolic syndrome (MetS).
23403707 The rs11705701 G>A polymorphism of IGF2BP2 is associated with IGF2BP2 mRNA and protein levels in the visceral adipose tissue - a link to type 2 diabetes susceptibility.
23364967 2013 Association of variants in PPAR?², IGF2BP2, and KCNQ1 with a susceptibility to gestational diabetes mellitus in a Korean population.
23300278 2013 Genome-wide association study identifies a novel locus contributing to type 2 diabetes susceptibility in Sikhs of Punjabi origin from India.
23257922 2013 IGF2 mRNA binding protein p62/IMP2-2 in hepatocellular carcinoma: antiapoptotic action is independent of IGF2/PI3K signaling.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23144361 2012 Evaluation of genome-wide association study-identified type 2 diabetes loci in African Americans.
23029108 2012 IGF2BP2 alternative variants associated with glutamic acid decarboxylase antibodies negative diabetes in Malaysian subjects.
22923468 2012 Contribution of common genetic variation to the risk of type 2 diabetes in the Mexican Mestizo population.
22899010 2012 Imp2 controls oxidative phosphorylation and is crucial for preserving glioblastoma cancer stem cells.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22770937 IGF2BP2 and IGF2 genetic effects in diabetes and diabetic nephropathy.
22693455 2012 Stratifying type 2 diabetes cases by BMI identifies genetic risk variants in LAMA1 and enrichment for risk variants in lean compared to obese cases.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22581228 2012 A genome-wide approach accounting for body mass index identifies genetic variants influencing fasting glycemic traits and insulin resistance.
22427968 2012 Two isoforms of the mRNA binding protein IGF2BP2 are generated by alternative translational initiation.
22245690 2012 Strong association of common variants in the IGF2BP2 gene with type 2 diabetes in Lebanese Arabs.
22233651 2012 A genome-wide association study of gestational diabetes mellitus in Korean women.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22096510 2011 Association of six single nucleotide polymorphisms with gestational diabetes mellitus in a Chinese population.
22032244 2012 IGF2BP2 genetic variation and type 2 diabetes: a global meta-analysis.
22015911 2012 Quantitative assessment of the variation in IGF2BP2 gene and type 2 diabetes risk.
21839790 2011 Association between IGF2BP2 rs4402960 polymorphism and risk of type 2 diabetes mellitus: a meta-analysis.
21771882 2011 p62/SQSTM1 in autophagic clearance of a non-ubiquitylated substrate.
21576258 2011 mTOR phosphorylates IMP2 to promote IGF2 mRNA translation by internal ribosomal entry.
21573907 2011 Genome-wide association study of type 2 diabetes in a sample from Mexico City and a meta-analysis of a Mexican-American sample from Starr County, Texas.
21422097 2011 Genetic variation in insulin-like growth factor 2 may play a role in ovarian cancer risk.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21145819 2011 Overexpression of the IGF2-mRNA binding protein p62 in transgenic mice induces a steatotic phenotype.
20956565 2010 Role of the RNA-binding protein IMP-2 in muscle cell motility.
20929593 2010 The longitudinal association of common susceptibility variants for type 2 diabetes and obesity with fasting glucose level and BMI.
20889853 2011 Genetic risk reclassification for type 2 diabetes by age below or above 50 years using 40 type 2 diabetes risk single nucleotide polymorphisms.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20879858 2010 Impact of single nucleotide polymorphisms and of clinical risk factors on new?onset diabetes mellitus in HIV?infected individuals.
20816152 2010 Obesity and diabetes genetic variants associated with gestational weight gain.
20802253 2010 Glycemia determines the effect of type 2 diabetes risk genes on insulin secretion.
20712903 2010 Obesity and diabetes genes are associated with being born small for gestational age: results from the Auckland Birthweight Collaborative study.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20627640 2010 IGF2BP1, IGF2BP2 and IGF2BP3 genotype, haplotype and genetic model studies in metabolic syndrome traits and diabetes.
20616309 2010 Coronary artery calcification and its relationship to validated genetic variants for diabetes mellitus assessed in the Heinz Nixdorf recall cohort.
20581827 2010 Twelve type 2 diabetes susceptibility loci identified through large-scale association analysis.
20580033 2010 Replication of recently described type 2 diabetes gene variants in a South Indian population.
20550665 2010 Association study of genetic variants in eight genes/loci with type 2 diabetes in a Han Chinese population.
20523342 2010 IGF2BP2 variations influence repaglinide response and risk of type 2 diabetes in Chinese population.
20509872 2010 Implication of genetic variants near SLC30A8, HHEX, CDKAL1, CDKN2A/B, IGF2BP2, FTO, TCF2, KCNQ1, and WFS1 in type 2 diabetes in a Chinese population.
20490451 2010 Type 2 diabetes risk alleles near ADCY5, CDKAL1 and HHEX-IDE are associated with reduced birthweight.
20424228 2010 Impact of common variants of PPARG, KCNJ11, TCF7L2, SLC30A8, HHEX, CDKN2A, IGF2BP2, and CDKAL1 on the risk of type 2 diabetes in 5,164 Indians.
20384434 2010 Combining genetic markers and clinical risk factors improves the risk assessment of impaired glucose metabolism.
20215779 2009 Evidence of interaction between type 2 diabetes susceptibility genes and dietary fat intake for adiposity and glucose homeostasis-related phenotypes.
20203524 2010 Genetic susceptibility to type 2 diabetes is associated with reduced prostate cancer risk.
20161779 2010 Investigation of type 2 diabetes risk alleles support CDKN2A/B, CDKAL1, and TCF7L2 as susceptibility genes in a Han Chinese cohort.
20142250 2010 Diabetes genes and prostate cancer in the Atherosclerosis Risk in Communities study.
20080952 2010 ZBP1 recognition of beta-actin zipcode induces RNA looping.
20075150 2010 Utility of genetic and non-genetic risk factors in prediction of type 2 diabetes: Whitehall II prospective cohort study.
20043145 2010 Improvements in glucose homeostasis in response to regular exercise are influenced by the PPARG Pro12Ala variant: results from the HERITAGE Family Study.
19933996 2010 Examination of all type 2 diabetes GWAS loci reveals HHEX-IDE as a locus influencing pediatric BMI.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19892838 2010 Polymorphisms identified through genome-wide association studies and their associations with type 2 diabetes in Chinese, Malays, and Asian-Indians in Singapore.
19862325 2009 PPARG, KCNJ11, CDKAL1, CDKN2A-CDKN2B, IDE-KIF11-HHEX, IGF2BP2 and SLC30A8 are associated with type 2 diabetes in a Chinese population.
19808892 2010 Combined risk allele score of eight type 2 diabetes genes is associated with reduced first-phase glucose-stimulated insulin secretion during hyperglycemic clamps.
19794065 2010 Polygenic risk variants for type 2 diabetes susceptibility modify age at diagnosis in monogenic HNF1A diabetes.
19741467 2009 Association of common type 2 diabetes risk gene variants and posttransplantation diabetes mellitus in renal allograft recipients in Korea.
19741166 2009 Common genetic determinants of glucose homeostasis in healthy children: the European Youth Heart Study.
19720844 2009 Use of multiple metabolic and genetic markers to improve the prediction of type 2 diabetes: the EPIC-Potsdam Study.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19602701 2009 Underlying genetic models of inheritance in established type 2 diabetes associations.
19592620 2009 Examination of type 2 diabetes loci implicates CDKAL1 as a birth weight gene.
19502414 2009 Association of 18 confirmed susceptibility loci for type 2 diabetes with indices of insulin release, proinsulin conversion, and insulin sensitivity in 5,327 nondiabetic Finnish men.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19401414 2009 Confirmation of multiple risk Loci and genetic impacts by a genome-wide association study of type 2 diabetes in the Japanese population.
19279076 2009 Genetic predisposition, Western dietary pattern, and the risk of type 2 diabetes in men.
19258437 2009 Genetic variant in the IGF2BP2 gene may interact with fetal malnutrition to affect glucose metabolism.
19258404 2009 The inhibitory effect of recent type 2 diabetes risk loci on insulin secretion is modulated by insulin sensitivity.
19247372 2009 Construction of a prediction model for type 2 diabetes mellitus in the Japanese population based on 11 genes with strong evidence of the association.
19228808 2009 Type 2 diabetes risk alleles are associated with reduced size at birth.
19225753 2009 Interaction between prenatal growth and high-risk genotypes in the development of type 2 diabetes.
19148120 2009 Variation in IGF2BP2 interacts with adiposity to alter insulin sensitivity in Mexican Americans.
19139842 2009 Risk prediction of prevalent diabetes in a Swiss population using a weighted genetic score--the CoLaus Study.
19082521 2009 Association between insulin secretion, insulin sensitivity and type 2 diabetes susceptibility variants identified in genome-wide association studies.
19033397 2009 Replication study of candidate genes associated with type 2 diabetes based on genome-wide screening.
19020324 2008 Clinical risk factors, DNA variants, and the development of type 2 diabetes.
19020323 2008 Genotype score in addition to common risk factors for prediction of type 2 diabetes.
19018773 2008 Insulin-like growth factor stimulation increases radiosensitivity of a pancreatic cancer cell line through endoplasmic reticulum stress under hypoxic conditions.
19008344 2009 Association analysis of variation in/near FTO, CDKAL1, SLC30A8, HHEX, EXT2, IGF2BP2, LOC387761, and CDKN2B with type 2 diabetes and related quantitative traits in Pima Indians.
19002430 2009 Type 2 diabetes-associated genetic variants discovered in the recent genome-wide association studies are related to gestational diabetes mellitus in the Korean population.
18991055 2008 Association between polymorphisms in SLC30A8, HHEX, CDKN2A/B, IGF2BP2, FTO, WFS1, CDKAL1, KCNQ1 and type 2 diabetes in the Korean population.
18984664 2009 Common type 2 diabetes risk gene variants associate with gestational diabetes.
18853134 2008 The search for putative unifying genetic factors for components of the metabolic syndrome.
18719881 2008 Beta cell glucose sensitivity is decreased by 39% in non-diabetic individuals carrying multiple diabetes-risk alleles compared with those with no risk alleles.
18711366 2008 SNPs in KCNQ1 are associated with susceptibility to type 2 diabetes in East Asian and European populations.
18694974 2008 Predicting type 2 diabetes based on polymorphisms from genome-wide association studies: a population-based study.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18633108 2008 Common variants in CDKAL1, CDKN2A/B, IGF2BP2, SLC30A8, and HHEX/IDE genes are associated with type 2 diabetes and impaired fasting glucose in a Chinese Han population.
18618095 2008 Variants of CDKAL1 and IGF2BP2 affect first-phase insulin secretion during hyperglycaemic clamps.
18598350 2008 Impact of nine common type 2 diabetes risk polymorphisms in Asian Indian Sikhs: PPARG2 (Pro12Ala), IGF2BP2, TCF7L2 and FTO variants confer a significant risk.
18597214 2008 Variants of the PPARG, IGF2BP2, CDKAL1, HHEX, and TCF7L2 genes confer risk of type 2 diabetes independently of BMI in the German KORA studies.
18591388 2008 Assessing the combined impact of 18 common genetic variants of modest effect sizes on type 2 diabetes risk.
18544707 2008 Extension of type 2 diabetes genome-wide association scan results in the diabetes prevention program.
18516622 2008 Type 2 diabetes susceptibility loci in the Ashkenazi Jewish population.
18477659 2008 Replication of genome-wide association studies of type 2 diabetes susceptibility in Japan.
18469204 2008 Implication of genetic variants near TCF7L2, SLC30A8, HHEX, CDKAL1, CDKN2A/B, IGF2BP2, and FTO in type 2 diabetes and obesity in 6,719 Asians.
18443202 2008 Association analysis in african americans of European-derived type 2 diabetes single nucleotide polymorphisms from whole-genome association studies.
18430866 2008 Evaluation of the association of IGF2BP2 variants with type 2 diabetes in French Caucasians.
18426861 2008 Association analysis of type 2 diabetes Loci in type 1 diabetes.
18372903 2008 Meta-analysis of genome-wide association data and large-scale replication identifies additional susceptibility loci for type 2 diabetes.
18259684 2008 Search for type 2 diabetes susceptibility genes on chromosomes 1q, 3q and 12q.
18162508 2008 Association of CDKAL1, IGF2BP2, CDKN2A/B, HHEX, SLC30A8, and KCNJ11 with susceptibility to type 2 diabetes in a Japanese population.
17928989 2007 Variations in the HHEX gene are associated with increased risk of type 2 diabetes in the Japanese population.
17827400 2007 Studies of association of variants near the HHEX, CDKN2A/B, and IGF2BP2 genes with type 2 diabetes and impaired insulin release in 10,705 Danish subjects: validation and extension of genome-wide association studies.
17804762 2007 Common variants of the novel type 2 diabetes genes CDKAL1 and HHEX/IDE are associated with decreased pancreatic beta-cell function.
17463249 2007 Replication of genome-wide association signals in UK samples reveals risk loci for type 2 diabetes.
17463248 2007 A genome-wide association study of type 2 diabetes in Finns detects multiple susceptibility variants.
17463246 2007 Genome-wide association analysis identifies loci for type 2 diabetes and triglyceride levels.
17426251 2007 HMGA2 regulates transcription of the Imp2 gene via an intronic regulatory element in cooperation with nuclear factor-kappaB.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17296566 2007 Expression of the RNA-binding protein VICKZ in normal hematopoietic tissues and neoplasms.
17289661 2007 Molecular composition of IMP1 ribonucleoprotein granules.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16368877 2006 Genomic annotation of 15,809 ESTs identified from pooled early gestation human eyes.
16049158 2005 Expression of IGF-II mRNA-binding proteins (IMPs) in gonads and testicular cancer.
15618018 2005 Effect of all-trans-retinoic acid on mRNA binding protein p62 in human gastric cancer cells.
15601260 2005 VICKZ proteins: a multi-talented family of regulatory RNA-binding proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15225648 2004 Differential regulation of the insulin-like growth factor II mRNA-binding protein genes by architectural transcription factor HMGA2.
12849008 2002 Autoantibodies to IGF-II mRNA binding protein p62 and overexpression of p62 in human hepatocellular carcinoma.
12674497 2003 Identification and characterization of proteins that selectively interact with isoforms of the mRNA binding protein AUF1 (hnRNP D).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10190901 1999 A novel cytoplasmic protein with RNA-binding motifs is an autoantigen in human hepatocellular carcinoma.
9891060 1999 A family of insulin-like growth factor II mRNA-binding proteins represses translation in late development.