Property Summary

NCBI Gene PubMed Count 148
PubMed Score 57.27
PubTator Score 81.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Expression

  Differential Expression (20)

Disease log2 FC p
Astrocytoma, Pilocytic 2.000 8.4e-06
atypical teratoid / rhabdoid tumor 2.000 1.8e-03
Barrett's esophagus 1.600 9.2e-03
Breast cancer -1.700 3.0e-08
esophageal adenocarcinoma 2.100 1.8e-02
glioblastoma 1.200 7.3e-03
group 3 medulloblastoma -1.200 2.9e-02
intraductal papillary-mucinous adenoma (... 1.300 5.1e-03
intraductal papillary-mucinous neoplasm ... 1.900 2.9e-03
lung cancer -2.300 7.9e-04
lung carcinoma -1.900 6.3e-27
non-small cell lung cancer 1.468 2.6e-08
osteosarcoma -1.807 2.2e-02
pancreatic cancer 1.200 3.0e-05
pancreatic ductal adenocarcinoma liver m... 2.688 1.5e-03
pediatric high grade glioma 1.300 5.7e-03
posterior fossa group A ependymoma 1.200 2.2e-03
primitive neuroectodermal tumor 2.100 2.7e-02
psoriasis -1.500 8.1e-04
spina bifida -1.792 3.7e-02

Gene RIF (137)

AA Sequence

MMNKLYIGNLSPAVTADDLRQLFGDRKLPLAGQVLLKSGYAFVDYPDQNWAIRAIETLSGKVELHGKIME      1 - 70
VDYSVSKKLRSRKIQIRNIPPHLQWEVLDGLLAQYGTVENVEQVNTDTETAVVNVTYATREEAKIAMEKL     71 - 140
SGHQFENYSFKISYIPDEEVSSPSPPQRAQRGDHSSREQGHAPGGTSQARQIDFPLRILVPTQFVGAIIG    141 - 210
KEGLTIKNITKQTQSRVDIHRKENSGAAEKPVTIHATPEGTSEACRMILEIMQKEADETKLAEEIPLKIL    211 - 280
AHNGLVGRLIGKEGRNLKKIEHETGTKITISSLQDLSIYNPERTITVKGTVEACASAEIEIMKKLREAFE    281 - 350
NDMLAVNQQANLIPGLNLSALGIFSTGLSVLSPPAGPRGAPPAAPYHPFTTHSGYFSSLYPHHQFGPFPH    351 - 420
HHSYPEQEIVNLFIPTQAVGAIIGKKGAHIKQLARFAGASIKIAPAEGPDVSERMVIITGPPEAQFKAQG    421 - 490
RIFGKLKEENFFNPKEEVKLEAHIRVPSSTAGRVIGKGGKTVNELQNLTSAEVIVPRDQTPDENEEVIVR    491 - 560
IIGHFFASQTAQRKIREIVQQVKQQEQKYPQGVASQRSK                                   561 - 599
//

Text Mined References (158)

PMID Year Title