Property Summary

NCBI Gene PubMed Count 21
PubMed Score 0.00
PubTator Score 2.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Synonym

Accession Q6U949 A5PKV8 A6NNQ2 Q7Z712 Q9P2W0
Symbols PEG8
IGF2AS
IGF2-AS1

Gene

 Compartment GO Term (0)

Pathway (1)

Gene RIF (14)

PMID Text
24824313 Germline variations in IGF2-AS gene were associated with prostate cancer mortality, independent of stage and Gleason score and specific to prostate cancer.
23193016 The strongest evidence for altered methylation patterns in shiftworkers was observed for IGF2AS gene.
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20564319 Meta-analysis of gene-disease association. (HuGE Navigator)
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19767753 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
17289909 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12603530 IGF-IR and IGF-IIR antisense genes could significantly restrain the malignant behavior of human hepatoma cells and might be useful in investigating a potential route for hepatocellular carcinoma gene therapy.

AA Sequence

MSKRKWRGFRGAQQERAQPPAASPQPCPAPHAGLPGGSRRRAPAPAGQQQMRAESRSGAQRRRGSARRGA      1 - 70
HREAGGCVRGRTRSSGSERSNALWQAVDAAEALALSSPLRRPWDQAQHFTNPAPFSKGPQSAPPSPPAGR     71 - 140
RRRGADLALTPLAGEGHTRWRQPGRPGK                                              141 - 168
//

Text Mined References (23)

PMID Year Title
24824313 2014 Insulin-like growth factor pathway genetic polymorphisms, circulating IGF1 and IGFBP3, and prostate cancer survival.
23193016 2013 Methylation alterations at imprinted genes detected among long-term shiftworkers.
21829393 2011 Genome-wide association analysis of autoantibody positivity in type 1 diabetes cases.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20564319 2010 Prostate cancer risk-associated variants reported from genome-wide association studies: meta-analysis and their contribution to genetic Variation.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19767753 2009 Identification of seven new prostate cancer susceptibility loci through a genome-wide association study.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
17632545 2007 A genome-wide association study identifies KIAA0350 as a type 1 diabetes gene.
17554260 2007 Robust associations of four new chromosome regions from genome-wide analyses of type 1 diabetes.
17289909 2007 IGF-II gene region polymorphisms related to exertional muscle damage.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12702581 2003 Loss of imprinting of IGF2 sense and antisense transcripts in Wilms' tumor.
12603530 2003 Effects of insulin-like growth factors-IR and -IIR antisense gene transfection on the biological behaviors of SMMC-7721 human hepatoma cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.
10731720 2000 Expression and imprinting status of human PEG8/IGF2AS, a paternally expressed antisense transcript from the IGF2 locus, in Wilms' tumors.