Property Summary

NCBI Gene PubMed Count 543
PubMed Score 4331.73
PubTator Score 2551.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Type 1 diabetes mellitus 104 0.0 2.0
Disease Target Count Z-score Confidence
Silver-Russell syndrome 37 5.323 2.7
Prostate cancer 172 0.0 5.0

Expression

  Differential Expression (22)

Gene RIF (479)

PMID Text
26840070 the evidence of strong associations between methylation of insulin-like growth factor 2/H19 and macrosomia induced by intrauterine hyperglycemia.
26760116 Low-oxygen tension can modify the IGF-1 or IGF-2 signaling via the IGF-1R and IR in placental mesenchymal stem cells.
26751131 suggest that molecular subtypes of the LIN-28B/let-7a/IGF-II axis associate with heterogeneous progression
26676988 These results demonstrate that IGF2 mRNA expression is more upregulated in fibroadenomas (FAs) and phyllodes tumors (PTs) than in normal tissues
26496499 IGF2 expression in infantile hemangioma is strongly related to the expression of a cancer testes and suspected oncogene BORIS.
26407907 SUZ12 is a key molecule in the regulation of monoallelic expression of IGF2.
26400872 Differential IGF2 and H19 expression characterize pheochromocytomas and adrenocortical carcinomas. Aberrant DNA methylation is found throughout the IGF2/H19 locus. Somatic copy number changes of chr11p15.5 are abundant and correlate with overexpression.
26397886 We conclude that recombinant adenovirus-mediated siRNA targeting CD147 based on the IGF2 LOI system inhibited the growth of the LOI cells in vitro and in vivo, which would provide a novel approach for targeted CRC gene therapy.
26336825 PAPP-A in ascites and tissue-associated PAPP-A serve to increase IGF bioactivity and, thereby, to stimulate IGF-IR-mediated ovarian tumor growth.
26333472 DNA methylation in imprinted genes IGF2 and GNASXL is associated with prenatal maternal stress
26154720 IGF2 variant (c.191C-->A, p.Ser64Ter) with evidence of pathogenicity in a family with four members who have growth restriction. Dysmorphic features are consistent with a role of deficient IGF-II levels in the cause of the Silver-Russell syndrome.
26118397 cord blood levels significantly reduced in intrauterine growth restriction
26116569 We propose that these interactions occur at the IGF2 and H19 gene cluster and are involved in the formation of loops between the IGF2 and H19 promoters and the enhancer, and thus the expression of the corresponding genes
26068014 Serum IGF2 was increased in hepatocellular carcinoma patients compared to patients with liver cirrhosis, but lower than in healthy controls.
26066673 There is a positive loop interaction between FSH and IGF-2 that is critical for human granulosa cell proliferation and differentiation.
26063585 Data provide evidence that IGF2 expression is frequently increased in ovarian cancer tissues, and high expression of IGF2 may be a significant prognostic factor for poor survival in ovarian cancer patients.
26063187 Ox-LDL induces NF-kappaB activation and IL-6 expression via IGF2 activation in macrophages.
26056800 High Insulin-like Growth Factor 2 Gene Expression is associated with Embryonal Rhabdomyosarcoma.
26056743 We hypothesised that the associations between increased maternal distress symptoms and changes in placental gene expression including IGF2 and genes regulating fetal glucocorticoid exposure are more pronounced in SO pregnancy.
26015264 Therefore, our results suggest that IGF-II can promote cartilage integrity and halt knee joint destruction in Osteoarthritis
25993872 IGF-II, TGF-beta1 and VEGF-A and its receptor in malignant tumor tissue, as well as increasedplasmin release from proenzyme and MMP-3 activationis apparently associated with the formation of pathogenic mechanism of vasculature development
25987019 High IGF2 expression is associated with Hepatocellular Carcinoma.
25971976 Overexpression of IGF2 led to beta-cell dedifferentiation and endoplasmic reticulum stress causing islet dysfunction.
25931278 Data indicate insulin like growth factor 2 (IGF2) as one of the top upregulated transcripts before and during early in vitro osteogenic differentiation.
25918994 The IGF2 gene was variably methylated in monozygotic twins discordant for depressive disorder.
25890304 There was a positive correlation between the IGF2 levels of and those of inflammatory mediators in HIV Infections.
25874233 Biologic roles of estrogen receptor-beta and insulin-like growth factor-2 in triple-negative breast cancer.
25771989 GF2 gene may be aging-related gene and involved in Osteoporosis.
25743702 IGF2 on chromosome 11p is overexpressed in 100% of the examined paediatric adrenocortical tumours.
25740666 Positive expression of IGF2 in spinal giant cell tumor was associated with increased microvessel density and expression of IMP3.
25739014 The present study revealed the pleiotropic impact of the single clustered hepatic metastamiRs miR-96-5p and miR-182-5p on IGF-1R, and an inducing effect on IGF-II and IGFBP-3 in hepatocellular carcinoma.
25719943 Imp2 regulates the activity of IGF2, which further activates PI3K/Akt signaling.
25670080 These studies reveal a GATA2-IGF2 aggressiveness axis in lethal prostate cancer and identify a therapeutic opportunity in this challenging disease
25639378 Hypomethylation of the differently methylated imprinting center region 1 between the IGF2 and H19 loci on chromosome 11p15 is associated with Russell-Silver syndrome.
25556430 Expression of IGF2 in several HCC cell lines was lower than in normal cell lines
25503665 IGF-II was associated with birth weight and expressed at high levels, which suggests that IGF-II may continue to play an important role after birth. H19 DMR methylation may be involved in controlling IGF-II expression
25458127 Both flanks of the IGF-II C domain play important roles in the greater ability of IGF-II to bind and activate IR receptors than IGF-I.
25435370 fluid shear stress induces the synthesis of Insulin growth factor-2 and vascular endothelial growth factor (VEGF) B and D, which in turn transactivate MMP-12.
25423083 upregulation of IGF2/Igf2 is likely controlled by hypermethylation of H19 DMR1 in human NTDs, however, in acute external RA-induced NTD mice it is potentially determined by more open chromatin structure
25395389 Exhaustive methylation analysis revealed uneven profiles of methylation at IGF2/ICR1/H19 11p15 loci in Russell Silver syndrome.
25293351 Data indicate that methylation levels at insulin-like growth factor 2 (IGF2)/H19 long non-coding RNA (H19) imprinted regions were associated with maternal body mass index (BMI).
25292066 Loss of imprinting of insulin-like growth factor 2 is associated with increased risk of primary lung cancer.
25277046 The blood proteins IGF1, IGF2, IBP2, IBP3 and A2GL have been proposed as indirect biomarkers for detection of GH administration and as putative biomarkers for breast cancer diagnosis.
25200291 Data suggest that signaling/feedback via insulin and insulin-like growth factors (IGF1 and IGF2) is important during neurogenesis and in maintaining homeostasis of the central nervous system. [REVIEW]
25171170 This review explores the association between birth weight, working memory and epigenetic signatures in IGF2 and related genes: a monozygotic twin study. [review]
25110432 Report association between histopathological findings and IGF2 differentially methylated region hypomethylation in serrated colorectal neoplasms.
25090267 As in Dupuytren's disease, beta-catenin levels and IGF2 expression are elevated in Frozen Shoulder Syndrome.
25089899 These observations confirm the active role of IGF2 in adrenocortical tumor growth.
25086101 IGFII and N33 methylation status may be related to gastric carcinogenesis.
25001656 data highlight the importance of IGF-II in fetal growth and suggest that gender differences should be taken into consideration when evaluating prenatal growth.
24986528 The gene expression pattern of CDKN1C, H19, IGF2, KCNQ1 and PHLDA2 genes was evaluated using RT-PCR.
24972507 Maternal first trimester urinary concentrations of phthalate and phenol biomarkers are correlated with DNA methylation and allele-specific expression of IGF2 and non-coding gene H19 in placenta samples.
24956249 There was a significant association between IGF2 methylation and genotype, but no significant association between genetic or epigenetic variability and metabolic parameters in the present study.
24932685 High IGF2 mRNA expression is significantly associated with ovarian cancer progression.
24915949 Low expression of IGF-1 and high expression of IGF-2 and IGFBP-3 in the placental tissue depending on preeclampsia severity were detected.
24804818 High expressions of IGF2 and FGFR3 are significantly associated with tumour progression.
24732467 IGF2 increased the protein levels of hippocampal BMP9, NGF, BDNF, NT3 and IGF1 and of doublecortin, a marker of neurogenesis.
24725430 results reveal the functional relevance of vigilin and CTCF, and show that the CTCF-vigilin complex contributes to regulation of Igf2/H19
24706416 High IGF2 is associated with esophageal squamous cell carcinoma.
24685003 CSF and blood plasma levels of IGF-II and some of its binding proteins are changed in patients with Alzheimer's disease
24656929 IGF-2, IGF-2R, and IRS-2 genes polymorphisms and their combinations are associated with risk of HCC
24599933 Data indicate that the inhibitor of DNA binding 1 (Id1)-IGF-II-IGF-IR-AKT signaling cascade plays an important role in esophageal cancer progression.
24558376 IGF2 has a role in imprinting through NF-kappaB activation and oxidative stress
24498411 High IGF2 expression is associated with adrenocortical tumors.
24469060 ZFP57 regulates the expression of insulin-like growth factor 2 (IGF2), which has a critical role in ZFP57-induced anchorage-independent growth
24454871 Our findings show that IGF2 mRNA levels at 12 weeks gestation could provide a useful predictor of future fetal growth to term, potentially predicting SGA babies
24451943 results suggest that polymorphic variants of the IGF2 genes modulate gastric carcinogenesis. Moreover, when the IGF2 and IGFBP3 variants are evaluated together, a greater effect on GC risk is observed
24407433 Insulin-like growth factor 2 immunoreactivity is diffuse in the majority of benign liver nodular lesions but in only a minority of hepatocellular carcinomas.
24380854 IGF-2 induction of AHR promotes the expression of CCND1 and the proliferation of MCF-7 cells.
24349121 IGF2 and H19 DNA methylation is associated with fetal and infant growth.
24318096 IGF2 DMR0 hypomethylation was associated with esophageal squamous cell carcinoma.
24266751 A modified recombinant hNAGLU fused to the receptor-binding motif of IGF-II (rhNAGLU-IGF-II) enhances its ability to enter cells using the cation-independent mannose 6-phosphate receptor, which is the receptor for IGF-II at a different binding site.
24184209 This is the first report of a long non-coding RNA regulated by insulin/IGFs.
24182837 Our results indicate that IGF2 and IGFBP6 appear to govern various regulatory feedback mechanisms in periodontal ligament cells
24178245 This study has confirmed that adrenocortical carcinoma overexpress signal transducer and activator of transcription 3 and insulin-like growth factor 2
24112161 the expression of CLDN1 and IGF2 indicate a poor prognosis in stage N2 non-small cell lung cancer
24081183 higher baseline IGF-II and IGFBP-2 predict increased HDL concentration over time, implicating IGF-II in modulation of circulating HDL-cholesterol concentrations.
23962719 data demonstrate that aberrant IGF2 imprinting in tumor cell lines is related to the loss of histone H3K27 methylation suppression mark in the gene promoter
23943562 H19 CBS6 hypermethylation is related to the loss of genomic imprinting of IGF2
23890452 Single nucleotide polymorphisms in the IGF2, CCL2, and ELN genes may be associated to the degree and recovery time of non-contact soft tissue injuries.
23844573 preeclampsia induced a decrease in methylation level at IGF 2 DMR
23775149 altered DNA methylation at imprinted domains including IGF2/H19 and PEG1/MEST may mediate the association between human papillomavirus infection and invasive cervical cancer
23757053 the IGF2 gene and its gene product may be important determinants of longitudinal weight trends in type 2 diabetes.
23750643 study suggests a potential gene-epigene interaction between a T allele in the IGF2 imprinting control region (ICR)1 and methylation of ICRs of IGF2, and fetal growth
23725790 Single nucleotide polymorphisms associated with methylation at IGF2-imprinting control regions suggests parent-of-origin association.
23714241 We found that IGF-2 and IGFBP2 synergistically increased neurite outgrowth via enhanced early signaling through the IGF type 1 receptor.
23690138 Data indicate that insulin-like growth factor 2 (IGF2) gene is a promising candidate gene to study for a greater understanding of the cause of neural tube defects (NTDs).
23677070 findings suggest that the intronic SNP rs4320932 affects patient survival and chemotherapy response via alteration of DNA conformation, but not through regulation of IGF-II expression
23623986 This is the first report to implicate IGFBP-6 as a suppressor of cellular proliferation and IGF-II as an inducer of cellular contractility in this connective tissue disease.
23620526 Data indicate that loss of imprinting (LOI) of H19 was observed for 4% of individuals in cord blood and 3.3% in placenta, and for IGF2 of 22% of individuals in the cord blood and 0% in placenta.
23558990 results imply that IGF2 imprinting status has no obvious impact on its expression. There may be some unknown important factors other than imprinting status driving IGF2 expression.
23539881 Results showed that IGF2 ApaI and IFG2 receptor Gly1619Arg gene polymorphisms are not associated with male infertility.
23530192 down-regulation of E2f3 with age helps drive the dramatic decline in Igf2 expression in postnatal organs, and E2F3 overexpression in cancer induces IGF2 overexpression
23497056 Microglia are important sources of both neurotrophic growth factors IGF1 and IGF2; microglial activation phenotypes can influence growth factor expression.
23485847 IGF-2 gene activity is significantly increased in leiomyoma tissue compared to normal myometrium.
23479510 HIF2A and IGF2 expression correlates in human neuroblastoma cells and normal immature sympathetic neuroblasts.
23410103 IGF-II is an activator of osteoblasts, although with less force compared to IGF-I, but not the activator of the osteo-erosive population, demonstrating its overall effect on the cells of the bone in favour of a new bone formation.
23388414 Hypomethylation at the IGF2 differentially methylated region was associated with paternal obesity; data indicate a preconceptional impact of paternal obesity on the reprogramming of imprint marks during spermatogenesis.
23363476 Serum preptin levels are decreased in osteoporosis and osteopaenia patients and positively correlated with bone mineral density.
23319492 IGF2 increases de novo steroidogenesis in prostate cancer cells
23299523 This work reveals the fundamental importance of IGF-II in the mature podocyte for glomerular health across mammalian species.
23257688 There is a substantial amount of research linking IGF2 to growth disorders, cancer and to a much lesser degree cardiovascular disease. Some studies on IGF2 and tumor growth have yielded conflicting results, for instance regarding its effect on apoptosis.
23227253 Allele-specific expression for H19, IGF2 and IGF2R in first trimester (6-12 weeks gestation) and term placentae, were quantified.
23207153 Epigenetic alterations in the IGF-II gene regulate its transcription and expression and are closely associated with hepatocellular carcinoma development and progression.
23171475 Investigated the feasibility of using the IGF2 imprinting system for targeted gene therapy of colorectal cancer.
23166326 IGF-II isoforms possess unique biological properties that may enable them to escape normal sequestration avenues and remain bioavailable in vivo to sustain oncogenic signaling
23151531 None of the folate cycle genotypes in the mother or infant were related to the methylation of IGF2, PEG3, or LINE-1.
23118352 Microdeletions in the IGF2/H19 imprinting control region affect binding to CTCF.
23079386 IGF2 gene expression in rhabdomyosarcoma tumors.
23079385 Secretion of IGF-II is affected by TNF-alpha only
23047069 These findings implicate an important role of IGF2 in expanding hemangioma stem cells and preventing terminal adipocyte differentiation.
23039012 The genotype frequencies did not differ statistically between low birth weight (AA = 16.22%, AG = 43.24%, GG = 40.54%) and control (AA = 20% AG = 35%, GG= 45% groups) and the allele frequencies were not significantly different (p > 0.05).
23035551 It was assumed that the ApaI polymorphism of the IGF2 gene influences the human cognitive functions, acting possibly via modulation of the IGF-II level in the central nervous system.
23028800 p53 activation following ionizing radiation led to a decrease in IGF2 expression.
23023303 PLAG1 binding to the IGF2 P3 promoter and IGF2 expression is cell type-specific, and that the PLAG1 transcription factor acts as a transcriptional facilitator that partially overrides the insulation by the H19 ICR.
22994732 The average serum level of IGF-2 in the 60 patients with HCC was 136.5 +/- 87.3 pg/ml.
22982059 Data suggest that only a fraction of circulating insulin-like activity is due to insulin itself; serum IGF-I and IGF-II may substantially contribute to insulin receptor signaling.
22926517 Our data add IGF2 in breast cancer to the list of cancer-relevant miR-100 targets
22907587 IGF2 DNA methylation could represent a cornerstone in linking birth weight and fetal metabolic programming of late onset obesity
22902352 These observations suggest a decrease of Igf2 methylation from cirrhosis to HCC in patients with HCV infection, which may be an additional risk factor for HCC.
22893718 Gestational diabetes up-regulates MT1-MMP in the feto-placental endothelium, and insulin and IGF-II contribute.
22879348 study investigated DNA methylation of the imprinted IGF2/H19 locus; data suggest aging more than population genetics is responsible for the inter-individual variability in DNA methylation patterns; DNA methylation variability appears to be highly region-specific
22800756 With the combination of stabilized beta-catenin and elevated Igf2 expression, adrenal glands were larger, displayed earlier onset of hyperplasia, and developed more frequent macroscopic adenomas.
22770937 genetic association studies: Data suggest that there are genetic interactions between an SNP in IGF2 (rs10770125) and an SNP in IGF2BP2 (IGF2 mRNA binding protein 2; rs4402960) with a protective effect in male patients with type 1 diabetes.
22684773 downregulation of IGF-II expression resulted in the viability alteration, proliferation inhibition, and apoptosis occurrence of HepG2 cells.
22679513 significant IGF2 hypermethylation (20 +/- 10 vs. 14 +/- 7%; p<0.05) and SNURF hypomethylation (23 +/- 6 vs. 32 6%; p<0.001) was found in Albright's hereditary osteodystrophy patients vs. controls.
22666415 Prenatal famine and genetic variation showed similar associations with IGF2/H19 methylation and their contributions were additive
22662119 IGF-2 is involved in the development of breast cancer, and its expression varies in different tissues (benign breast lesions, breast cancer and tumor-adjacent tissue).
22646060 IGF2 hypomethylation is associated with very low birthweight, preocious pubarche and insulin resistance.
22630333 Tobacco smoking during pregnancy decreases the pregnancy-associated plasma protein A and insulin growth factors I and II levels.
22571677 VEGF may play a regulator role in human ovarian physiology by modulating the expression of IGF-II and IGFBP-5 in luteinized granulosa cells.
22565227 Data indicate an inverse association between the insulin-like growth factor-2 (IGF-II) Apa1 A-variant and colon cancer risk (OR = 0.49, 95 % CI 0.28-0.88) in Whites only.
22527168 There was no evidence of any dietary associations with IGFBP-3 or IGF-II.
22486985 this study suggests that heparin and IGF-II, but not IGF-I, may be important regulators of trophoblast survival in early and late pregnancy.
22479380 Data indicate that genetic variants in folate pathway genes showed associations including infant MTRR 66G>A genotype and maternal MTHFR 677C>T genotype with IGF2 methylation.
22447362 Patients with hypermethylated IGF2 in blood leukocyte DNA showed a significantly better survival rate.
22434232 IGF-IR-mediated activation of intracellular signaling may play a critical role during oxidative stress-induced apoptosis in necrotizing enterocolitis.
22399759 IGF2 is a novel regulator of adult hippocampal neurogenesis.
22395465 DNA methylation, particularly in the vicinity of a key CTCF-binding site (CTCF3) in the imprinting control region (ICR) upstream of H19, is strongly correlated with cerebellum weight.
22392079 variation in IGF2 differentially methylated regions is an important mechanism by which circulating IGF2 concentrations are modulated
22377707 IGF2R polymosphisms modulate serum IGF2 levels in a sex-specific manner and may increase cancer risk.
22372631 IGF-1R and IGF-1 are expressed in the majority of chordomas but IGF-1 expression is much stronger than IGF-2 expression.
22347413 Heavy smokers carrying susceptible IGF1, IGF2, and IGFBP3 polymorphisms have a higher risk of lung cancer.
22341586 Findings suggest that IGF2 plasticity may be mechanistically important in early childhood overweight or obese status
22309801 irrespective of polycystic ovary syndrome (PCOS) status, women with impaired glucose tolerance had higher serum preptin levels compared with women with normal glucose tolerance; preptin levels are related with glucose tolerance status, but not with PCOS status
22253890 Prospective associations of insulin, IGF-I, IGF-II and IGFBP-3 with physical performance in Caerphilly Prospective Study and cross-sectional insulin, IGF-I, IGF-II, IGFBP-2 and IGFBP-3 in the Boyd Orr cohort, were examined.
22253814 These findings do not provide evidence for a substantial influence of these common polymorphisms in the GH/IGF axis on objectively measured physical capability levels in older adults.
22248018 findings suggest as causative in SRS a defective mechanism necessary for establishment or maintenance of imprinting marks, which affects imprinted loci in general with low specificity and the IGF2/H19 locus with high specificity
22245250 Retinoic acid regulates prolidase activity in human dermal cells via IGF receptor signaling in photoaged cells.
22242132 This study aimed at establishing and clarifying the effect of cord serum insulin, IGF-II, IGFBP-2, cortisol and IL-6 concentrations on birth length and weight.
22189999 Adaptive increases in IGF2 and IGF1 are found in insulin receptor-deficient individuals.
22188815 Data suggest that tumor-derived IGF-2 in the microenvironment maintains angiogenesis in the presence of IGF-1R-targeted antibodies allowing tumor progression.
22140443 This study has lead to a greater understanding of the mechanisms of IGF-II binding and activation of the IGF-1R and IR-A.
22121898 Specific hypomethylated CpGs at the IGF2 locus act as an epigenetic biomarker for familial adenomatous polyposis colorectal cancer.
22098246 The SNP in IGF-II genes (-13021C)may be an important risk factors for the recurrence of HCC.
22082268 The placental lectins have no effect on the binding of IGF-II to IGF II Receptor.
22069105 Class I homozygosity at 5'VNTR is a significant risk factor of T1DM and acts independently from HLA haplotype in determining the actual risk of diabetes in children.
22042095 IGF2 and IMP3 had different expression patterns, which might be associated with angiogenesis. However, cytoplasmic and nuclear expression of IGF2 and IMP3 might play different roles in the angiogenesis of osteosarcoma.
21926269 Polymorphic variation (4 SNP) in paternally transmitted fetal IGF2 is associated with increased maternal glucose concentrations in pregnancy.
21889930 The present study aims to establish the levels of acylated ghrelin, desacylated ghrelin, obestatin and preptin, during pregnancy and the postpartum period in pregnant women with Gestational Diabetes Mellitus (GDM) and healthy pregnancy women.
21880216 Findings confirmed a major role of maternal age in addition to IGF-II, IL-6 and TNF-alpha in Intra-Uterine Growth Restricted (IUGR) pregnancies.
21852217 We genotyped single-nucleotide polymorphisms of IGF1, IGF2, IGF1R, IGF2R, IGFBP1, IGFBP3, IGFBP5, IRS1, IRS2, and IRS in pancreatic cancer patients
21823995 In placentas from pregnancies with IUGR an overexpression of the IGF-2 and the insulin-like growth factor binding protein (IGFBP)-3 genes was found.
21805044 Results suggest the involvement of the IGF2 imprinted gene in placental function and fetal growth and the possible association of epigenetic alterations with the pathophysiology of fetal growth restriction.
21798010 The cytoprotective effects of IGF-II are related to mitochondrial protection leading to increased ATP production reducing free radical generation, oxidative damage and apoptosis.
21761181 molecular dynamics simulation was performed on the IGF-II/IGF2R complex to describe the features of the protein-protein interaction in detail; identified the key residues in the IGF-II/IGF-2R interaction; results from the calculation were consistent with reported experimental mutagenesis studies
21757716 IMP-3 acts in part through the IGF-II pathway to promote cell survival in response to ionizing radiation
21744995 High IGF2 mrna is associated with rabdomyosarcoma.
21733157 Low doses of IGF-II induce hepatoprotective, neuroprotective and metabolic effects, improving mitochondrial function, without affecting testosterone and IGF-I levels.
21708937 Associations were found between risk of breast cancer and linkage disequilibrium blocks in IGF2 for BRCA1 and BRCA2 mutation carriers, HTRA1 for BRCA1 carriers, and MMP3 for BRCA2 carriers.
21704210 In vitro fertilization/intracytoplasmic sperm injection did not affect DNA methylation at H19/IGF2 ICR1 in the placenta.
21672538 IGF2 derived from SH-SY5Y neuroblastoma cells induces the osteoclastogenesis of human monocytic precursors
21668571 IGF2 expression was low in normal and dysplastic squamous epithelium but was increased 1.97-fold in malignancy.
21636975 Methylation variation at IGF2 differentially methylated regions and maternal folic acid use before and during pregnancy
21613208 IMP3 as a glioblastoma-specific proproliferative and proinvasive marker acting through IGF-2 resulting in the activation of oncogenic PI3K and MAPK pathways
21576258 Double phosphorylation promotes IMP2 binding to the IGF2 leader 3 mRNA 5' untranslated region, and the translational initiation of this mRNA
21548981 The authors conclude that during hepatitis B/C virus infection, O-beta-GlcNAc of IGFBP-6 at Ser 204 diminish their binding with IGF-II, increase IGF-II cellular expression and promote cancer progression.
21536749 CTCF epigenetically governs allelic gene expression of IGF2 by orchestrating chromatin loop structures involving PRC2
21535266 IGF1 might inhibit insulinogenic differentiation of HEAC, whereas IGF2 enhances differentiation, and enhancement of IGF2 appears to be mediated via IR
21506705 expression of IGF-II and MMP-9 mRNA were significantly elevated in hepatocellular carcinoma (HCC) in liver tissues of patients compared with healthy controls
21432864 LOI of IGF2 occurs not only adjacent to prostate tumor foci, but is widely prevalent in distant areas within the peripheral zone. These data show a widespread epigenetic field defect in normal tissues that might be employed to identify prostate cancer.
21410323 in breast cancer cells, IGF-2 activates ER-alpha and ER-beta, and modulates their translocation to nucleus, membrane organelles and mitochondria; IGF-2 actions are mediated by the IGF-1R and the insulin receptor
21380782 High IGF2 is associated with colorectal adenocarcinoma.
21282187 with the CTCF site downstream of the enhancers. The two alternative chromatin conformations are differently favoured in BWS and SRS likely predisposing the locus to the activation of IGF2 or H19, respectively.
21278389 These cases define a novel aetiology of the growth retardation in SRS, namely, dissociation of IGF2 from its enhancers.
21268128 Data suggest that LOI of IGF2 may be a potentially important clinical epigenetic marker to identify individuals at increased risk for gastric malignancy.
21251749 genetic association studies: IGF-II SNP 820G>A (in 3' untranslated region) is associated with endometriosis in a Korean population of women; endometriosis was observed 1.99 times more frequently in GG genotype
21238444 a significant relationship between IGF-II, MMP9 and ventricular septal defects which might be used as diagnosis and prognosis indicators for this defect
21164426 preptin concentrations increase in maternal serum of women with gestational diabetes mellitus
21109978 The study suggests that DNA methylation regulates IGF-II promoter-specific expression in ovarian cancer
21078522 Genetic variation with IGFII and IGFBP-3 may influence endometrial cancer risk in Caucasians.
21078522 Observational study of gene-disease association. (HuGE Navigator)
20945273 The aim of this study was to evaluate the relationship between levels of IGF-II or IGFBP-3 in cervical scrapes with cervical cancer and precancerous lesions.
20937833 Long range interactions regulate Igf2 gene transcription during skeletal muscle differentiation
20929508 Relevance of insulin-like growth factor 2 in the etiopathophysiology of diabetic nephropathy
20884247 Data indicate after 3 cycles of treatment IGF-1 significantly declined, IGFBP-1 significantly increased, and IGF-2 and IGFBP-3 were not significantly changed.
20861572 The high morbility of the FGR with hypertentive disorder complicating pregnancy has no relationshipswith the imprinting status of IGF-II and H19 genes.
20842449 ASCL1-pathway is responsible for the up-regulation of IGF2 during neuroblastoma differentiation.
20734064 Observational study of gene-disease association. (HuGE Navigator)
20709701 Case Report: diagnosis of solitary fibrous tumor with IGF-2 production.
20673868 Observational study of gene-disease association. (HuGE Navigator)
20661447 in vitro conception is associated with aberrant methylation patterns at the IGF2/H19 locus
20651370 IGF2*A allele and CDH1*C allele were correlated with leiomyoma susceptibility, which may be associated with leiomyoma development.
20651370 Observational study of gene-disease association. (HuGE Navigator)
20639793 Results identified polymorphisms in IGF2R, IGF2, and near H19 that are associated with birth weight.
20639793 Observational study of gene-disease association. (HuGE Navigator)
20637510 IGF-2 is a trophic factor for oligodendrocyte lineage cells and is one of a group of mediators contributing to the effects of glatiramer acetate-reactive T helper (Th) type 2 cells on oligodendrocyte progenitor cultures in vitro.
20634197 Meta-analysis of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20592487 Cell lines with IGF2 LOI (HCT-8, HT-29 and H-522) that were infected with AdDC312-EGFP produced the EGFP protein. However, in cells in which imprinting was maintained (MOI) (MCF-7 and GES-1), no EGFP protein was produced.
20564319 Meta-analysis of gene-disease association. (HuGE Navigator)
20540659 Maternal IGF2 has a significant positive correlation with preeclampsia.
20484977 Gene expression pattern of IGF2 imprinted genes in spontaneous miscarriages or fetal deaths.(
20483645 IGF2/ApaI polymorphisms in patients with cutaneous melanoma
20483645 Observational study of gene-disease association. (HuGE Navigator)
20479215 loss of imprinting at the IGF2 locus leads to an increase of IGF2 expression as the one associated with gain of 11p15.5 and results in increased expression of proliferation-related genes and an expansion of the intestinal crypt progenitor cells in mice
20472480 Brief, high intensity exercise does alter IGF-II bioactivity
20468064 Observational study of gene-disease association. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20452482 Observational study of gene-disease association. (HuGE Navigator)
20443017 IGF2 was found to be one of the candidates for acquired CDDP-resistance.
20427254 there is a significant association betwwen igf-ii and decreased cancer mortality
20422427 Significant loss of methylation in exon 9 CpG cluster of IGF2 in breast tumor tissues was observed when compared to normal tissue.
20418667 ICR1 methylation status is a necessary and sufficient condition to drive the imprinting of IGF2 and H19 present in embryonic as well as in extra-embryonic tissues.
20416304 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20403997 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20403354 Observational study of gene-disease association. (HuGE Navigator)
20388800 miR-483-3p has a role in cancer at the IGF2/483 locus
20364576 IGF2 increased in both mid-aged and replicative senescent cells, but increased obviously in premature senescent cells compared to young cells. In the promotor region, the methylation level for IGF2 was detected only in replicative senescent cells.
20338046 We investigated methylation patterns in the promoter regions of ABCB1, ATM, BRCA1, CDH3, CDKN2A, CXCR4, ESR1, FBXW7, FOXC1, GSTP1, IGF2, HMLH1, PPP2R2B, and PTEN75 in well-described pre-treatment samples from locally advanced breast cancer
20206398 Integrative genomic analysis showed enrichment of activation of IGF signaling in the Proliferation subclass of hepatocellular carcinoma
20157191 loss of imprinting of IGF-II is significantly associated with poor prognosis in patients with stage IV colorectal cancer
20119675 IGF-2 gene polymorphisms are associated with the susceptibility and pathological development of hepatocellular carcinoma.
20119675 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20089431 IGF-II and the anti-apoptotic proteins differential expression among AA and CA patients may contribute to the breast cancer survival disparities observed between these ethnic groups.
20057340 There is a significant association between the 6815 A/T IGF2 gene variant and high systolic blood pressure in obese children. Homozygote subjects for the T6815 allele showed a higher risk to develop hypertension than those carrying the A6815 allele
20057340 Observational study of gene-disease association. (HuGE Navigator)
20042264 expression level of imprinted gene IGF2 in the endometrium of women with unexplained infertility was increased compared with controls.
20027339 FGF-2 levels were detected in patients with tumors of different histological structure.
20010889 DNA methylation at IGF2 is significantly correlated with brain weight
20007505 Analysis of the IGF2 imprinting control region uncovers new genetic defects, including mutations of OCT-binding sequences, in patients with 11p15 fetal growth disorders
19962924 Mature IGF-II prevents the formation of "big" IGF-II/IGFBP-2 complex in the circulation of healthy human controls.
19957330 results suggest that IGF2 participates in colorectal neoplasms tumorigenesis through 2 different forms of aberrant gene expression
19956846 frequent combined aberrant methylation of the IGF2-H19 locus and LINE1 in the vast majority of ovarian carcinoma samples suggests that these changes are important events in tumorigenesis
19956766 cohesin has a critical role in maintaining CTCF-mediated chromatin conformation at the at the IGF2-H19 locus locus and disruption of this conformation coincides with changes in IGF2 expression.
19953105 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19950580 Expression profiles of human VIGILIN, H19, and IGF2 mRNA increased with cell-cycle prograssion.
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19938957 Serum IGF-II levels, which appeared to be negatively correlated with elevated E2, decreased in polycystic ovary syndrome patients early after hMG & hCG administration when monitored for 24 h, while no such changes were observed in IGF-I & IL-6.
19924280 Periconceptional folic acid use is associated with epigenetic changes in IGF2 in the child that may affect intrauterine programming of growth and development with consequences for health and disease throughout life
19919531 These results suggest that positive feedback regulation of bFGF and IGFs leads to proliferation of UCB-MSCs.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19876004 Observational study of gene-disease association. (HuGE Navigator)
19843644 analysis of the loss of imprinting of the insulin-like growth factor II (IGF2) gene in esophageal normal and adenocarcinoma tissues
19786462 Body mass index contributes to racial differences in IGF2
19769965 M6P/IGF2R is involved in the regulation of CREG-mediated IGF-II endocytosis
19767753 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19749460 The expression of factor IGF-II and its receptor, IGF-1R was significantly higher in breast carcinoma having Loss of Heterozygosity at WT1 locus.
19737423 IGF2 loss of imprinting is present in high frequency in Chinese gastric cancer patients, especially those with gastric corpus cancer.
19724140 Preliminary X-ray analysis of the complexes between a Fab and two forms of human insulin-like growth factor II at 2.2 A resolution, is reported.
19713175 results indicate that the levels of placental insulin-like growth factor 2 and insulin-like growth factor I receptor may be involved in the development of macrosomia
19692168 Observational study of gene-disease association. (HuGE Navigator)
19689072 The loss of imprinting of IGF-2 could be involved in the development of breast cancer.
19672298 combination of SDF-1, PTN, IGF2, and EFNB1 mimics the DA phenotype-inducing property of SDIA and was sufficient to promote differentiation of hESC to functional midbrain DA neurons
19625176 Observational study of gene-disease association. (HuGE Navigator)
19598235 Observational study of gene-disease association. (HuGE Navigator)
19588890 the presence of IGF-2 in the nucleus of cells cultured from human fetal thymus and its association with the insulin-linked polymorphic region in the chromatin of these cells
19586133 The results suggest that upregulation of the IGF pathway in pediatric undifferentiated soft tissue sarcomas is a critical early event in the development of sarcomas.
19584898 The DNA methylation status of 47 CpGs located in differentially methylated regions (DMRs), IGF2 gene and in the 3rd and 6th CTCF-binding sites of the H19 DMR in human sperm from men with normal semen and infertile patients, was analysed.
19560381 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19549920 This study population does not support the hypothesis that colon cancer can be predicted from the different degrees of methylation in the IGFII gene from lymphocyte DNA.
19546867 In the parent-of-origin specific association analysis, in which only the paternally inherited allele was incorporated, the 1156T>C single nucleotide polymorphism showed significant association with IGF-binding protein 1 levels
19546867 Observational study of gene-disease association. (HuGE Navigator)
19513555 Report aberrant epigenetic modifications in the CTCF binding domain of the IGF2/H19 gene in prostate cancer compared with benign prostate hyperplasia.
19502451 Methylation of IGF2 might be a useful biomarker for classification and staging of pancreatic endocrine tumors.
19499149 data indicated that Hcy could induce hypomethylation of the sixth CTCF-binding sites upstream of H19, which is an important regulating area for the imprinting expression of IGF2 and H19
19453261 Observational study of gene-disease association. (HuGE Navigator)
19427670 hypomethylation of the IGF2-P3 promoter correlates with expression of P3 transcripts in osteosarcoma.
19421925 The combined analyses of both polymorphism revealed that the genotypes IGF-2 (GG)/ PON-1 (TT) and IGF-2 (AA)/ PON-1 (TT) were more frequent in the PCOS group, whereas the genotype IGF-2 (AA)/ PON-1 (CC) did not occur in the PCOS group at all.
19421925 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19417744 IGF-1 was significantly positively associated with birth weight and birth length in Boston, but not Shanghai. In contrast, stronger positive, though statistically non-significant, associations of IGF-2 with birth size were only evident in Shanghai
19407853 IGF2 protein expression among mesenchymal tumors is largely consistent with gene expression studies and suggests a potential for molecular therapy targeting the IGF signaling pathway system in these neoplasms.
19390492 Data suggest that inheriting the IGF2 CTG haplotype from a paternal allele results in reduced feto-placental growth, but it is not associated with the methylation status of IGF2/H19.
19390492 Observational study of gene-disease association. (HuGE Navigator)
19367319 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19365888 Tissue markers of hypoglycemia: insulin growth factor-II and E-domain of proinsulin growth factor-II expression in solitary fibrous tumor of the pleura.(Case Report)
19336370 Observational study of gene-disease association. (HuGE Navigator)
19333718 data demonstrated that preptin is involved in bone anabolism mediated by ERK/CTGF in human osteoblasts and may contribute to the preservation of bone mass observed in hyperinsulinemic states, such as obesity
19317253 IGF-II (insulin-like growth factors-2) can enhance KCC1 (KC1 co-transport-1) gene expression in cervical cancer cells through signal transduction pathways
19293570 methylation defects at the IGF2-H19 locus can result from inherited mutations of the imprinting center and have high recurrence risk or arise independently from the sequence context and not transmitted to the progeny
19276395 We identified pro-IGF-IIE[68-88] as a marker that may be used in the surveillance of GIST.
19259766 Increased high-molecular-weight insulin-like growth factor II is associated with giant phyllodes tumor of the breast with hypoglycemia.
19242102 Loss of genomic imprinting of the IGF2 gene in PBL appears to be a stable epigenetic phenomenon in most colorectal cancer patients and may be a risk factor for colorectal cancer predisposition
19218281 Significantly higher IGF2 expression is associated with adrenocortical carcinomas compared to adrenocortical adenomas.
19208780 The function of the Gly1619Arg non-synonymous amino acid modification of domain 11, was evaluated.
19207313 Serum levels of IGF-1, IGF-2, ALS, and IGFBP-3 were reduced in children with congenital disorders of glycosylation.
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19127217 Effects of different CMV-heat-inactivation-methods on IGF-2 in human breast milk.
19124506 Observational study of gene-disease association. (HuGE Navigator)
19121847 Insulin-like growth factor-II and insulin-like growth factor binding protein-3 may be novel prognostic markers in metastatic ovarian carcinoma.
19066168 findings demonstrate that hypomethylation of H19 or IGF2 alone appears to be sufficient to cause Silver-Russell syndrome(SRS); germ cell mosaicism & vertical transmission from an affected father to his child shows a recurrence risk for epimutations in SRS
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19064563 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19034281 we found 12 childhood hematoblasoma tumours (22%) with LOH in IGDF2, 9 (17%) with loss of imprinting (LOI) and 33 (61%) with retention of imprinting (ROI).
18980977 We suggest that CDH1 cytoplasmic immunolocalization as a result of increased IGF-II levels identifies those nonmuscle invasive presentations most likely to recur
18955703 In humans, low birth weight correlates with hypomethylation of the IGF2 promoter.
18931647 Report overexpression of IGF2 in pancreatic islets of nesidioblastosis patients.
18832656 locally generated IGF2 at either ischemic or tumor sites may contribute to postnatal vasculogenesis by augmenting the recruitment of endothelial progenitor cells
18803353 hypomethylation at the Igf2 locus in the liver could be predictive for the occurrence of hepatocellular carcinoma in hepatitis C virus cirrhosis
18794369 Data identify a novel transcriptional activity at both the human and the mouse H19/IGF2 imprinted loci.
18788888 Expression of the IGF2 ligand is associated with translocation-negative tumors and may serve as a diagnostic aid in distinguishing rhabdomyosarcoma subtypes.
18786438 IGF2 was overexpressed in childhood adrenocortical tumors with maternal, but not paternal, allele loss of heterozygosity at 11p15. It did not relate to clinical outcome.
18772331 Neuraminidase caused the desialylation of both PDGF and IGF-1 receptors and diminished the intracellular signals induced by the mitogenic ligands PDGF-BB and IGF-2.
18728168 A break point 184 kb upstream of the paternally derived IGF2 gene resulted in reduced expression in some mesoderm-derived adult tissues causing intrauterine growth retardation, short stature, lactation failure, and insulin resistance.
18719053 Women with localized, early-stage breast cancer show elevated circulating free IGF1 and IGF2, reduced total IGF2 and alterations in IGFBPs
18701505 Loss of insulin-like growth factor 2 imprinting is associated with the development of prostate cancer
18676680 Observational study of gene-disease association. (HuGE Navigator)
18636124 Observational study of gene-disease association. (HuGE Navigator)
18619647 Our findings indicate that colorectal cancers with demethylation of the insulin-like growth factor II gene are distinct from normal imprinting tumors, both in clinical and genetic features.
18616667 Competitive equilibrium binding assays revealed significantly reduced specific binding to the insulin, IGF-I, and IGF-II and their receptors in both the anterior cingulate and vermis of alcoholic human brains.
18611974 IGF-II transcripts were overexpressed in both pediatric adrenocortical carcinomas and adenomas.
18607558 Data suggest a positive role of the IGF2 expression level, as reflected by the methylation index, in the determination of body and placental growth in epimutation-positive patients, except for the brain where IGF2 is expressed biallelically.
18604514 Results decribethe loss IGF2/H19 imprinting,loss of heterozygosity of IGF2R and CTCF, and incidental H. pylori infections in laryngeal squamous cell carcinoma.
18573128 The presence of IGF-2 ApaI polymorphism in partners of recurrent spontaneous abortion (RSA) women could affect IGF-2 level of expression in placenta and embryo and represent a risk factor for RSA susceptibility.
18573128 Observational study of gene-disease association. (HuGE Navigator)
18562769 Observational study of gene-disease association. (HuGE Navigator)
18541649 Results indicate that IGF2 promoter proximal sequence hypomethylation is highly prevalent in cancer and detected more frequently than loss of imprinting.
18537183 Activation of IGF-II/IGF-IR signaling is likely a progression switch selected by function that promotes tumor cell dissemination and aggressive tumor behavior.
18524796 Markedly elevated IGF-II and IGFBP-2 serum levels in patients with non-seminomatous germ cell cancer, showing a significant decrease after successful therapy and an increase in recurrent disease.
18520331 Propose that IGF-II, mainly through the insulin receptor is involved in functional leydig cell differentiation.
18481170 IGF-I, IGF-II and IGFBP-3 mRNA expression and tissue levels of IGF peptides are regulated by different mechanisms
18467708 increased local IGF-II expression in SSc-associated pulmonary fibrosis both in vitro and in vivo as well as IGF-II-induced ECM production through both phosphatidylinositol-3 kinase- and Jun N-terminal kinase-dependent pathways.
18464243 three WT1 subtypes were correlated with WT1, IGF2, and CTNNB1 genetics
18428028 IGF-II differentially regulated the intracellular translocation of Bcl-2 and Bcl-X(L), a critical process in breast cancer progression to hormone-independence
18372285 IGF2 helps predict disease outcome in GIST patients.
18358696 Of the informative human hepatocellular carcinoma samples 47.06% (8 of 17) demonstrated a gain of imprinting of IGF2, and 21.74% (5 of 23) of the informative HCC samples demonstrated a loss of imprinting of H19.
18350600 Review of the insulin-like growth factor-II signaling pathway in human hepatocellular carcinoma.
18349294 Observational study of gene-disease association. (HuGE Navigator)
18308616 IGF2 is epigenetically regulated and has roles in development and disease [review]
18297687 Data show that vitamin C suppresses proliferation of the human melanoma cell line SK-MEL2 via the down-regulation of IGF-II production and IGF-IR expression, which is followed by the activation of p38 MAPK and the inhibition of COX-2 expression.
18287964 IGF-2 mRNA was expressed in congenital hemangiomas at a level comparable with that detected in common infantile hemangioma over 4 y of age.
18259111 Higher early levels of the human milk IGF system might contribute to maturation of the infant gut.
18245780 Methylation-imprinting defects at the IGF2-H19 locus can result from inherited mutations of the imprinting center and have high recurrence risk or arise independently from the sequence context and generally not transmitted to the progeny.
18199734 Genetic variants in the IGF-II genes is not associated with breast cancer
18159214 In 30% of patients, differentially methylated IGF2/H19 imprinting center region (ICR1) on chromosome 11p15 was found to be hypomethylated, as determined by Southern blot analysis of an HpaII restriction site close to third CTCF-binding site within ICR1
18085551 common genetic variants in the IGF2-INS-TH cluster modify susceptibility to idiopathic Parkinson's disease
18085551 Observational study of gene-disease association. (HuGE Navigator)
18035699 IGF-II may represent an excellent target for interferon gamma-treatment and specific siRNA-mediated therapeutic intervention in human hepatoma.
18022169 Endometrial IGF-I and -II are differentially regulated during decidualization and by human chorionic gonadotropin.
18006818 analysis of IGF2 and H19 loss of imprinting in bladder cancer
17972051 Observational study of gene-disease association. (HuGE Navigator)
17919721 Intrauterine growth restricted (IUGR) pregnancies are associated with normal value of IGF2 mRNA.
17786320 Upregulation of IGF-2 expression is associated with oral cancer.
17700581 Observational study of gene-disease association. (HuGE Navigator)
17667841 Demonstrate significant relationship between paternally transmitted haplotypes at INS-IGF2 locus and newborn IGF-II levels, but no association with maternally transmitted haplotypes.
17640993 Different members of Rho GTPase family regulate IGF-II-mediated EVT cell migration differentially, depending upon whether it signals through IGF1R or in an IGF1R-independent manner.
17639583 Duplication of the paternal IGF2 allele in trisomy 11 and elevated expression levels of IGF2 mRNA is associated with congenital mesoblastic nephroma
17635080 IGF-II metabolism may play a role in atherogenesis in in schizophrenic Arab subjects
17620336 that endogenous IGF-1 and IGF-2 receptors can independently initiate ERK1/2 signaling and point to a potential physiologic role for IGF-2 receptors in the cellular response to IGF-2
17591929 A panel of markers including at least RUNX3, CACNA1G, IGF2, and MLH1 can serve as a sensitive and specific marker panel for CIMP(Cpg island methylator phenotype)-high.
17569086 methylation varies among three IGF-II promoters in ovarian cancer and that this variation seems to have biologic implications as it relates to clinical features and prognosis of the disease.
17560154 Severely deficient in a case of insulin-resistance syndrome (Rabson-Mendenhall type).
17556377 These results demonstrate that the InsR regulates choriocarcinoma cell invasion through activation by IGF-II.
17488802 Observational study of gene-disease association. (HuGE Navigator)
17488802 We did not confirm the previously reported associations between IGF2 polymorphisms and body mass index, but common variation in the IGF2 gene may be associated with adult height
17475626 novel binding surface on IGF-II critical for IGF2R binding
17440932 Observational study of gene-disease association. (HuGE Navigator)
17407457 Observational study of gene-disease association. (HuGE Navigator)
17407457 There was a significant difference in birth weight standard deviation scores among the three neonatal +3123/Apal genotypes of the insulin-like growth factor 2 gene, indicating that the IGF2 gene variant is associated with fetal growth.
17369847 IGF-II and IGFBP-2 differentially regulate PTEN in human breast cancer cells
17360667 IGF2-PIK3R3 signaling axis is involved in promoting the growth of a subclass of highly aggressive human glioblastomas that lack EGF receptor amplification.
17341887 The results provide further evidence that IGFBP-2 and IGF-II in breast milk are relevant factors for the early development of preterm infants.
17339271 Variation in DNA methylation of the IGF2/H19 locus is mainly determined by heritable factors and single nucleotide polymorphisms (SNPs) in cis, rather than the cumulative effect of environmental and stochastic factors occurring with age.
17325026 Implication of IGF2 duplication in overgrowth and Wilms'tumorigenesis.
17310846 IGF2 may participate in carcinogenesis of esophageal cancer through its over-expression. IGF2 loss of imprinting.
17294726 IGF2 gain of imprinting and H19 loss of imprinting are common in hepatocellular carcinoma.
17289909 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17285535 In newborns of Chinese Han population, 21.6% showed IGF2 loss of imprinting (LOI) in cord blood, and IGF2 LOI may have some influences on fetal growth. Paternal age is associated with LOI.
17072986 IGF-II was shown to be a growth factor of hepatoblastoma via IGF-I receptor and PI3 kinase which were good candidates for target of molecular therapy
17029194 The risk of IGF-II gene imprinting loss is higher in female twins and has no relationship with assisted reproductive technology and zygosity.
16935391 High plasma levels of IGF-1, IGF-2, and IGFBP-3 were associated with good prognosis in patients with advanced NSCLC.
16926156 heterotrimeric G protein-dependent ERK1/2 activation is mediated by IGF-1 and IGF-2 by transactivating sphingosine 1-phosphate receptors
16888814 IGFs co-activate proliferative and apoptotic pathways in LIM 1215 cells, which may contribute to increased cell turnover.
16868148 Observational study of gene-disease association. (HuGE Navigator)
16857788 analysis of hypomethylated P4 promoter induction of expression of the insulin-like growth factor-II gene in hepatocellular carcinoma in a Chinese population
16750516 Observational study of gene-disease association. (HuGE Navigator)
16750516 IGF2 polymorphisms were found to be strongly associated with the clearance of hepatitis B virus (HBV) or the occurrence of hepatocellular carcinoma in patients with chronic HBV infection
16716263 IGF-I and -II are chemotactic factors for mesenchymal progenitor cells; IGFBP-5 both modulates the IGF-I effect and directly stimulates migration of human mesenchymal progenitor cells
16612114 Interplay between placental and fetal Igf2 regulates both placental growth and nutrient transporter abundance.
16603642 Elevated IGF2 expression is a frequent event in serous ovarian cancer and this occurs in the absence of IGF2 loss of imprinting.
16525660 Results suggest that loss of imprinting (LOI)of IGF2 in colorectal carcinoma and LOI in the background mucosa play important roles in carcinogenesis.
16518847 Association of 11q loss, trisomy 12, and possible 16q loss with loss of imprinting of insulin-like growth factor-II in Wilms tumor
16489075 IGF-II expression was found to be higher in tumors with poor prognosis.
16344718 Observational study of gene-disease association. (HuGE Navigator)
16330588 Observational study of gene-disease association. (HuGE Navigator)
16330588 A highly significant association was observed between the IGF2 ApaI G allele and scores on the Eating Attitudes Test overall and each of its subscales
16251897 Observational study of gene-disease association. (HuGE Navigator)
16247461 SYT-SSX1 induces insulin-like growth factor II expression in fibroblast cells.
16166779 Observational study of genotype prevalence. (HuGE Navigator)
16115888 PAPP-A increased the proliferation and differentiation of myoblasts, its myogenic effect is governed by its proteolytic activity, and it promotes skeletal myogenesis by increasing the amount of free IGFs.
16102992 Observational study of gene-disease association. (HuGE Navigator)
16102992 Polymorphisms of the IGF2 gene is associated with predisposition to high body mass index and obesity
16037384 Resveratrol regulates IGF-II and IGF-II mediates RSV effect on cell survival and growth in breast cancer cells.
16018936 Observational study of gene-disease association. (HuGE Navigator)
15987847 IGF II is an early indicators of fetal growth as measured in seconsd semestser amniotic fluid.
15970649 Observational study of gene-disease association. (HuGE Navigator)
15956340 C-domain of IGFBP-2 plays a key role in binding regions of IGF-I and -II that are also involved in binding to the type-1 IGF receptor
15954927 In sedentary, clinically stable maintenance hemodialysis patients as compared to sedentary normal individuals, the mRNA levels for IGF-IEa, IGF-II, and the IGF-I receptor are decreased in vastus lateralis muscle
15935984 IGF-II plays a role in colonic carcinogenesis from ulcerative colitis by interacting with interleukin 5.
15809062 PTEN may inhibit antiapoptotic IGF actions not only by blocking the IGF-IGFR-induced Akt activity, but also by regulating expression of components of the IGF system, in particular, upregulation of IGFBP-3
15799974 there is no finite M6P/IGF2R dimerization domain, but interactions between dimer partners occur all along the extracytoplasmic region of the receptor
15797461 The IGF2(67 amino acids) is single-chain polypeptides structurally similar to proinsulin.
15769738 observed, subsequent to knocking down CRD-BP/IMP1, decreased c-myc expression, increased IGF-II mRNA levels, and reduced cell proliferation rates
15731405 humans with loss of imprinting (LOI) of the IGF2 gene show a shift in differentiation in the normal colonic mucosa
15706404 Here, using quantitative real-time polymerase chain reaction (PCR) and immunohistochemistry, we show that IGF2 is highly expressed in both proliferating and involuting phase hemangioma, but is not detectable in other vascular lesions.
15701574 mature IGF-II is more effective in down-regulating the IGF-IR than pIGF-II
15645136 there is a disturbed regulation of the IGF-2/H19 locus in myeloid leukemias which is not caused by loss of imprinting
15642732 plasminogen binds with high affinity to IGF-II and IGF-binding protein-3
15621215 Observational study of gene-disease association. (HuGE Navigator)
15528386 IGF-2 may play a role in the selective recruitment of basophils in vivo.
15471867 novel mechanism for IGF2 imprinting regulation, that is, the reduction of CTCF expression in the control of IGF2 imprinting
15355996 CRD-BP has a dominant role in proliferation of human K562 cells by an IGF-II-dependent mechanism independent of its ability to serve as a c-myc mRNA masking protein
15298990 Observational study of gene-disease association. (HuGE Navigator)
15298990 variation within IGF2, a gene known to influence developing muscle, affects muscle mass and muscle function in later life.
15217931 free IGF-II but not IGF-I may have a role in progression of breast cancer
15205474 The C and D domains of IGF-II promote higher affinity binding to the IR-A than the equivalent domains of IGF-I.
15191555 IGF-II enhances the expression of VEGF in HaCaT cells by increasing HIF-1alpha levels.
15181035 Observational study of gene-disease association. (HuGE Navigator)
15163116 IGF-II gene APA I polymorphism can not serve as a candidate gene marker for screening rheumatoid arthritis patients in Taiwan.
15140223 IGF-II:VN and IGF-I:IGFBP-5:VN complexes may be useful in situations where enhanced keratinocyte cell migration and proliferation is required, such as in wound healing and skin regeneration.
15003992 Fibroblast proliferation, differentiation into myofibroblasts, & increased collagen synthesis are regulated via a CTGF-dependent pathway in concert with either EGF or IGF-2.
14996863 Our findings support the hypothesis that LOI of IGF-II is an epigenetic trait polymorphic in the population and suggest that LOI of IGF-II may play a role in colorectal cancer.
14764950 In human fetuses, IGF-I and IGF-II levels increase longitudinally throughout pregnancy.
14749349 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
14749262 Observational study of gene-disease association. (HuGE Navigator)
14749262 Both first- and second-phase insulin secretion were not significantly different between the various IGF-I or IGF-II genotypes.
14710345 Serum IGF-I shows positive correlations with myoblast retrieval in control patients that is lost in malignancy.
14695992 PLAG1 regulates promoter P3-dependent transcription of IGF2 in hepatoblastomas.
14645508 AT-rich DNA sequences located in the vicinity of previously characterized differentially methylated regions (DMRs) of the imprinted Igf2 gene are conserved between mouse and human.
14645199 Observational study of gene-disease association. (HuGE Navigator)
14614750 Observational study of gene-disease association. (HuGE Navigator)
13679437 IGF2, a potent growth factor, may play a role in the development or progression of clear cell sarcoma of the kidney.
12881524 214 transcripts were similarly regulated by insulin and IGF-II through Insulin Receptor A, whereas 45 genes were differentially transcribed
12804776 PTEN modulates IGF2-mediated signaling. The phosphoprotein phosphatase activity of PTEN downregulates IGF-2 expression in hepatoma cells.
12782403 p53mt249 stimulates IGF-II dependent IGF-IR signaling by upregulating the expression of both ligand (IGF-II) and receptor (IGF-IR) through an autocrine and/or paracrine loop
12765950 circulating IGF-II levels may play a role in body weight regulation and development of obesity in men and women with normal glucose tolerance
12732844 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12727212 Data suggest that insulin-like growth factor-II (IGF-II) is complexed in vivo with intact insulin-like growth factor binding proteins (IGFBP-2) and with processed IGFBP-2 fragments, which do not impair the activity of IGF-II on cell survival.
12719950 Observational study of gene-disease association. (HuGE Navigator)
12702581 Human insulin-like growth factor II gene (IGF2) is overexpressed, and its imprinting is disrupted in many tumors, including Wilms' tumor.
12700030 IGF2 is maternally imprinted thus is expressed only through the paternal allele, also IGF2 is over expressed in ovarian tumors.
12637750 investigated the utility of loss of IGF2 imprinting as a marker of colorectal cancer risk
12610512 Observational study of gene-disease association. (HuGE Navigator)
12605037 Alterations in the IFGII imprinted region occur in juvenile nasopharyngeal angiofibroma.
12579496 Overexpression of IGF2 was found to play an important role in carcinogenesis of colorectal cancer.
12558805 mitogenic effects on Malassez cells in the normal periodontal ligament
12548223 effect of relaxin on cellular proliferation in WISH cells is likely through the transcriptional up-regulation of IGF-II
12532445 IGF-II was expressed in human hepatoma cell lines.
12519841 data demonstrate for the first time that serum levels of IGFs (including free fractions) and IGFBPs are not increased in euthyroid Graves' patients with active thyroid eye disease
12446294 Observational study of gene-disease association. (HuGE Navigator)
12388463 Glucose transporter gene expression in the jejunum in response to insulin-like growth factors in rat pups
12270940 The dependence of the methylation of a region of this gene depends on the primary methylation imprint about 90 kilobases away.
12243757 Data suggest a causal relation between telomere shortening and reduced expression of KGF and IGF-II in human fibroblasts.
12127559 Autocrine production of IGF-I and IGF-II may via IGF-IR play a significant role in the growth and megakaryocytic differentiation of K562 cells.
12125963 Brain tumor invasiveness in degrees from respect of the arachnoid membrane progressing to frank brain invasion correlated with increases in IGF-II and IGFBP-6 expression.
12075589 Observational study of gene-disease association. (HuGE Navigator)
12075589 Caucasians with the IGF2 A/A genotype exhibit higher fat mass than G/G individuals
12032304 igf2 expression regulates hemangioma growth and involution
12006706 determination of blood levels in adult patients with severe liver disease before and after orthotopic liver transplantation
12005306 cDNA probes were used to analyze the gene expression of IGF-II 6 in luteinized granulosa cells from different-sized follicles after ovarian hyperstimulation.
11969341 altered IGF-II and IGFBP-1 expression at the fetomaternal interface may be important in the pathophysiology of pre-eclampsia
11937266 Loss of genomic imprinting of IGF2 is strongly associated with cellular proliferation in normal hematopoietic cells.
11903044 Human insulin-like growth factor II leader 2 mediates internal initiation of translation
11889182 Association of H19 promoter methylation with the expression of IGF-II gene in adrenocortical tumors.
11849996 These data indicate that the translational machinery encounters major parts of IGF II-leader 1.
11811790 Contribution of residues A54 and L55 of the human insulin-like growth factor-II (IGF-II) A domain to Type 2 IGF receptor binding specificity
11793026 Insulin-like growth factor 2 (IGF2 ) gene variant is associated with overfeeding-induced metabolic changes. Insulin sensitivity decreased .
11448941 Observational study of gene-disease association. (HuGE Navigator)
8385745 IGF2 gene is imprinted, with expression from only the paternal allele.

AA Sequence

MGIPMGKSMLVLLTFLAFASCCIAAYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEEC      1 - 70
CFRSCDLALLETYCATPAKSERDVSTPPTVLPDNFPRYPVGKFFQYDTWKQSTQRLRRGLPALLRARRGH     71 - 140
VLAKELEAFREAKRHRPLIALPTQDPAHGGAPPEMASNRK                                  141 - 180
//

Text Mined References (547)

PMID Year Title
26840070 2016 Alteration in Expression and Methylation of IGF2/H19 in Placenta and Umbilical Cord Blood Are Associated with Macrosomia Exposed to Intrauterine Hyperglycemia.
26760116 2016 Low Oxygen Tension Modulates the Insulin-Like Growth Factor-1 or -2 Signaling via Both Insulin-Like Growth Factor-1 Receptor and Insulin Receptor to Maintain Stem Cell Identity in Placental Mesenchymal Stem Cells.
26751131 2016 LIN-28B/let-7a/IGF-II axis molecular subtypes are associated with epithelial ovarian cancer prognosis.
26676988 2016 Loss of imprinting of IGF2 in fibroadenomas and phyllodes tumors of the breast.
26496499 2015 A Common Polymorphism within the IGF2 Imprinting Control Region Is Associated with Parent of Origin Specific Effects in Infantile Hemangiomas.
26407907 2015 Restoration of IGF2 imprinting by polycomb repressive complex 2 docking factor SUZ12 in colon cancer cells.
26400872 2015 Copy number variations alter methylation and parallel IGF2 overexpression in adrenal tumors.
26397886 2015 Gene therapy for colorectal cancer by adenovirus-mediated siRNA targeting CD147 based on loss of the IGF2 imprinting system.
26336825 2015 PAPP-A proteolytic activity enhances IGF bioactivity in ascites from women with ovarian carcinoma.
26333472 2015 DNA methylation in imprinted genes IGF2 and GNASXL is associated with prenatal maternal stress.
26154720 2015 Paternally Inherited IGF2 Mutation and Growth Restriction.
26118397 2015 Differential effects of low birthweight and intrauterine growth restriction on umbilical cord blood insulin-like growth factor concentrations.
26116569 2015 Paxillin-dependent regulation of IGF2 and H19 gene cluster expression.
26068014 2015 The Circulating IGF System in Hepatocellular Carcinoma: The Impact of Liver Status and Treatment.
26066673 2015 FSH Regulates IGF-2 Expression in Human Granulosa Cells in an AKT-Dependent Manner.
26063585 2015 High IGF2 expression is associated with poor clinical outcome in human ovarian cancer.
26063187 2015 Ox-LDL Upregulates IL-6 Expression by Enhancing NF-?B in an IGF2-Dependent Manner in THP-1 Macrophages.
26056800 2015 Insulin-like Growth Factor 2 Gene Expression Molecularly Differentiates Pleuropulmonary Blastoma and Embryonal Rhabdomyosarcoma.
26056743 2015 Maternal distress associates with placental genes regulating fetal glucocorticoid exposure and IGF2: Role of obesity and sex.
26015264 2015 Insulin-Like Growth Factor II (IGF-II) Inhibits IL-1?-Induced Cartilage Matrix Loss and Promotes Cartilage Integrity in Experimental Osteoarthritis.
25993872 2015 [Changes in markers of proliferation, neoangiogenesis and plasminogen activation system in rectal cancer tissue].
25987019 2015 PU.1 Is Identified as a Novel Metastasis Suppressor in Hepatocellular Carcinoma Regulating the miR-615-5p/IGF2 Axis.
25971976 2015 Insulin-like Growth Factor 2 Overexpression Induces ?-Cell Dysfunction and Increases Beta-cell Susceptibility to Damage.
25931278 2015 Increased In Vitro Osteopotential in SHED Associated with Higher IGF2 Expression When Compared with hASCs.
25918994 2015 Genome-wide methylation study on depression: differential methylation and variable methylation in monozygotic twins.
25890304 2015 Insulin-like growth factors and related proteins in plasma and cerebrospinal fluids of HIV-positive individuals.
25874233 2015 Biologic roles of estrogen receptor-? and insulin-like growth factor-2 in triple-negative breast cancer.
25771989 2015 Comprehensive transcriptome analysis of mesenchymal stem cells in elderly patients with osteoporosis.
25743702 2015 Genomic landscape of paediatric adrenocortical tumours.
25740666 2015 Expression of IMP3 and IGF2 in giant cell tumor of spine is associated with tumor recurrence and angiogenesis.
25739014 2015 A pleiotropic effect of the single clustered hepatic metastamiRs miR-96-5p and miR-182-5p on insulin-like growth factor II, insulin-like growth factor-1 receptor and insulin-like growth factor-binding protein-3 in hepatocellular carcinoma.
25719943 2015 Imp2 regulates GBM progression by activating IGF2/PI3K/Akt pathway.
25670080 2015 A targetable GATA2-IGF2 axis confers aggressiveness in lethal prostate cancer.
25639378 2015 Adult phenotype of Russell-Silver syndrome: A molecular support for Barker-Brenner's theory.
25556430 2014 Induction of apoptosis by IGFBP3 overexpression in hepatocellular carcinoma cells.
25503665 2015 IGF-II expression and methylation in small for gestational age infants.
25458127 2015 Delineation of the IGF-II C domain elements involved in binding and activation of the IR-A, IR-B and IGF-IR.
25435370 2015 Fluid shear promotes chondrosarcoma cell invasion by activating matrix metalloproteinase 12 via IGF-2 and VEGF signaling pathways.
25423083 2014 Different epigenetic alterations are associated with abnormal IGF2/Igf2 upregulation in neural tube defects.
25416956 2014 A proteome-scale map of the human interactome network.
25395389 2015 Exhaustive methylation analysis revealed uneven profiles of methylation at IGF2/ICR1/H19 11p15 loci in Russell Silver syndrome.
25293351 2014 Dietary supplementation with polyunsaturated fatty acid during pregnancy modulates DNA methylation at IGF2/H19 imprinted genes and growth of infants.
25292066 2014 Loss of imprinting of insulin-like growth factor 2 is associated with increased risk of primary lung cancer in the central China region.
25277046 2015 Targeted mass spectrometry analysis of the proteins IGF1, IGF2, IBP2, IBP3 and A2GL by blood protein precipitation.
25200291 2014 Control of brain development and homeostasis by local and systemic insulin signalling.
25171170 2014 Birth weight, working memory and epigenetic signatures in IGF2 and related genes: a MZ twin study.
25110432 2014 IGF2 differentially methylated region hypomethylation in relation to pathological and molecular features of serrated lesions.
25090267 2014 IGF2 expression and ?-catenin levels are increased in Frozen Shoulder Syndrome.
25089899 2014 IGF2 promotes growth of adrenocortical carcinoma cells, but its overexpression does not modify phenotypic and molecular features of adrenocortical carcinoma.
25086101 2014 Methylation status of blood leukocyte DNA and risk of gastric cancer in a high-risk Chinese population.
25068994 2014 The role of the oncofetal IGF2 mRNA-binding protein 3 (IGF2BP3) in cancer.
25066218 2014 IGF-I sensitivity in Silver-Russell syndrome with IGF2/H19 hypomethylation.
25001656 Growth factors and metabolic markers in cord blood: relationship to birth weight and length.
24986528 2014 Relevance of genomic imprinting in intrauterine human growth expression of CDKN1C, H19, IGF2, KCNQ1 and PHLDA2 imprinted genes.
24972507 2014 The impact of first trimester phthalate and phenol exposure on IGF2/H19 genomic imprinting and birth outcomes.
24956249 2014 No association between genetic or epigenetic variation in insulin growth factors and antipsychotic-induced metabolic disturbances in a cross-sectional sample.
24932685 2014 Insulin-like growth factor 2 silencing restores taxol sensitivity in drug resistant ovarian cancer.
24916376 2014 Extensive investigation of the IGF2/H19 imprinting control region reveals novel OCT4/SOX2 binding site defects associated with specific methylation patterns in Beckwith-Wiedemann syndrome.
24915949 2014 Expression of insulin-like growth factors in the placenta in preeclampsia.
24904527 2014 The IGF Hormonal Network in Endometrial Cancer: Functions, Regulation, and Targeting Approaches.
24886724 2014 Low-dose insulin-like growth factor binding proteins 1 and 2 and angiopoietin-like protein 3 coordinately stimulate ex vivo expansion of human umbilical cord blood hematopoietic stem cells as assayed in NOD/SCID gamma null mice.
24883437 2014 IGF2: an endocrine hormone to improve islet transplant survival.
24846856 2014 Investigation of IGF2, Hedgehog and fusion gene expression profiles in pediatric sarcomas.
24804818 2014 High IGF2 and FGFR3 are associated with tumour progression in undifferentiated pleomorphic sarcomas, but EGFR and FGFR3 mutations are a rare event.
24732467 2014 IGF2 ameliorates amyloidosis, increases cholinergic marker expression and raises BMP9 and neurotrophin levels in the hippocampus of the APPswePS1dE9 Alzheimer's disease model mice.
24725430 2014 Vigilin interacts with CCCTC-binding factor (CTCF) and is involved in CTCF-dependent regulation of the imprinted genes Igf2 and H19.
24706416 2015 Long non-coding RNA 91H contributes to the occurrence and progression of esophageal squamous cell carcinoma by inhibiting IGF2 expression.
24685003 2014 Changes in cerebrospinal fluid and blood plasma levels of IGF-II and its binding proteins in Alzheimer's disease: an observational study.
24656929 2014 Impact of insulin-like growth factor 2, insulin-like growth factor receptor 2, insulin receptor substrate 2 genes polymorphisms on susceptibility and clinicopathological features of hepatocellular carcinoma.
24599933 2014 Id1-induced IGF-II and its autocrine/endocrine promotion of esophageal cancer progression and chemoresistance--implications for IGF-II and IGF-IR-targeted therapy.
24558376 2014 A novel pathway links oxidative stress to loss of insulin growth factor-2 (IGF2) imprinting through NF-?B activation.
24498411 2014 Differentially expressed proteins in malignant and benign adrenocortical tumors.
24469060 2015 The stem cell transcription factor ZFP57 induces IGF2 expression to promote anchorage-independent growth in cancer cells.
24454871 2014 Paternally expressed, imprinted insulin-like growth factor-2 in chorionic villi correlates significantly with birth weight.
24451943 2014 Role of polymorphisms of the IGF2 and IGFBP3 genes and risk of gastric carcinoma in China.
24407433 2014 Immunohistochemical stains of proliferating cell nuclear antigen, insulin-like growth factor 2 and clusterin help distinguish malignant from benign liver nodular lesions.
24380854 2014 Insulin like growth factor 2 regulation of aryl hydrocarbon receptor in MCF-7 breast cancer cells.
24349121 2013 DNA methylation of IGF2DMR and H19 is associated with fetal and infant growth: the generation R study.
24318096 2014 IGF2 DMR0 methylation, loss of imprinting, and patient prognosis in esophageal squamous cell carcinoma.
24266751 2014 Insulin-like growth factor II peptide fusion enables uptake and lysosomal delivery of ?-N-acetylglucosaminidase to mucopolysaccharidosis type IIIB fibroblasts.
24184209 2014 CRNDE, a long non-coding RNA responsive to insulin/IGF signaling, regulates genes involved in central metabolism.
24182837 2013 Autoregulation of insulin-like growth factor 2 and insulin-like growth factor-binding protein 6 in periodontal ligament cells in vitro.
24178245 2014 Expression of STAT3 and IGF2 in adrenocortical carcinoma and its relationship with angiogenesis.
24112161 2013 Expressions of CLDN1 and insulin-like growth factor 2 are associated with poor prognosis in stage N2 non-small cell lung cancer.
24081183 2014 Insulin-like growth factor-II and insulin-like growth factor binding protein-2 prospectively predict longitudinal elevation of HDL-cholesterol in type 2 diabetes.
23962719 2014 Promoter histone H3K27 methylation in the control of IGF2 imprinting in human tumor cell lines.
23943562 2014 H19 DMR methylation correlates to the progression of esophageal squamous cell carcinoma through IGF2 imprinting pathway.
23936387 2013 A possible mechanism behind autoimmune disorders discovered by genome-wide linkage and association analysis in celiac disease.
23890452 2013 Single nucleotide polymorphisms associated with non-contact soft tissue injuries in elite professional soccer players: influence on degree of injury and recovery time.
23844573 2013 Methylation levels at IGF2 and GNAS DMRs in infants born to preeclamptic pregnancies.
23775149 2014 PEG1/MEST and IGF2 DNA methylation in CIN and in cervical cancer.
23757053 2013 IGF2 gene polymorphisms and IGF-II concentration are determinants of longitudinal weight trends in type 2 diabetes.
23750643 2013 Association between birth weight and DNA methylation of IGF2, glucocorticoid receptor and repetitive elements LINE-1 and Alu.
23725790 2013 GWAS of DNA methylation variation within imprinting control regions suggests parent-of-origin association.
23714241 2013 Enhancement of IGF-2-induced neurite outgrowth by IGF-binding protein-2 and osteoglycin in SH-SY5Y human neuroblastoma cells.
23690138 2013 Altered methylation of IGF2 DMR0 is associated with neural tube defects.
23677070 2013 An insulin-like growth factor-II intronic variant affects local DNA conformation and ovarian cancer survival.
23623986 2013 IGF-II and IGFBP-6 regulate cellular contractility and proliferation in Dupuytren's disease.
23620526 2013 The prevalence of loss of imprinting of H19 and IGF2 at birth.
23593202 2013 Bivariate genome-wide association analyses identified genes with pleiotropic effects for femoral neck bone geometry and age at menarche.
23558990 2012 IGF2 expression in blood is not associated with its imprinting status in healthy pregnant Chinese women.
23539881 Insulin-like growth factor 2 and insulin-like growth factor 2 receptor gene polymorphisms in idiopathic male infertility.
23530192 2013 Evidence that Igf2 down-regulation in postnatal tissues and up-regulation in malignancies is driven by transcription factor E2f3.
23497056 2013 Insulin-like growth factor 1 and 2 (IGF1, IGF2) expression in human microglia: differential regulation by inflammatory mediators.
23485847 2013 Gene expression patterns of insulin-like growth factor 2 in human uterine fibroid tissues: a genetic study with clinical correlations.
23479510 2013 HIF2A and IGF2 expression correlates in human neuroblastoma cells and normal immature sympathetic neuroblasts.
23410103 2013 Effects and differentiation activity of IGF-I, IGF-II, insulin and preptin on human primary bone cells.
23388414 2013 Paternal obesity is associated with IGF2 hypomethylation in newborns: results from a Newborn Epigenetics Study (NEST) cohort.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23363476 2013 Lower circulating preptin levels in male patients with osteoporosis are correlated with bone mineral density and bone formation.
23319492 2013 IGF2 increases de novo steroidogenesis in prostate cancer cells.
23299523 2013 Insulin-like growth factor-II is produced by, signals to and is an important survival factor for the mature podocyte in man and mouse.
23257688 2013 Insulin-like growth factor 2 in development and disease: a mini-review.
23234360 2013 LC-MS/MS characterization of O-glycosylation sites and glycan structures of human cerebrospinal fluid glycoproteins.
23227253 2012 Quantitative allele-specific expression and DNA methylation analysis of H19, IGF2 and IGF2R in the human placenta across gestation reveals H19 imprinting plasticity.
23207153 2012 [Correlation between epigenetic alterations in the insulin growth factor-II gene and hepatocellular carcinoma].
23171475 2012 Gene therapy for colorectal cancer by an oncolytic adenovirus that targets loss of the insulin-like growth factor 2 imprinting system.
23166326 2013 Biochemical characterization of individual human glycosylated pro-insulin-like growth factor (IGF)-II and big-IGF-II isoforms associated with cancer.
23151531 2013 Folate in pregnancy and imprinted gene and repeat element methylation in the offspring.
23118352 2013 The molecular function and clinical phenotype of partial deletions of the IGF2/H19 imprinting control region depends on the spatial arrangement of the remaining CTCF-binding sites.
23079386 2012 Investigation of PAX3/7-FKHR fusion genes and IGF2 gene expression in rhabdomyosarcoma tumors.
23079385 2012 The production and regulation of IGF and IGFBPs in human adipose tissue cultures.
23047069 2013 Elevated IGF2 prevents leptin induction and terminal adipocyte differentiation in hemangioma stem cells.
23039012 2013 IGF2/ApaI polymorphism associated with birth weight in children of the region of Petrolina-PE, Brazil.
23035551 2012 [Association of the insulin-like growth factor II (IGF2) gene with human cognitive functions].
23028800 2012 p53 Stabilization induces cell growth inhibition and affects IGF2 pathway in response to radiotherapy in adrenocortical cancer cells.
23023303 2012 Cell type and context-specific function of PLAG1 for IGF2 P3 promoter activity.
22994732 2012 Association between insulin-like growth factor-2 expression and prognosis after transcatheter arterial chemoembolization and octreotide in patients with hepatocellular carcinoma.
22982059 2013 Circulating insulin-like growth factors may contribute substantially to insulin receptor isoform A and insulin receptor isoform B signalling.
22926517 2013 miR-100 suppresses IGF2 and inhibits breast tumorigenesis by interfering with proliferation and survival signaling.
22907587 2012 IGF2 DNA methylation is a modulator of newborn's fetal growth and development.
22902352 2012 Insulin-like growth factor 2 gene methylation in peripheral blood mononuclear cells of patients with hepatitis C related cirrhosis or hepatocellular carcinoma.
22893718 2012 Fetal insulin and IGF-II contribute to gestational diabetes mellitus (GDM)-associated up-regulation of membrane-type matrix metalloproteinase 1 (MT1-MMP) in the human feto-placental endothelium.
22879348 2012 Space/population and time/age in DNA methylation variability in humans: a study on IGF2/H19 locus in different Italian populations and in mono- and di-zygotic twins of different age.
22800756 2012 Progression to adrenocortical tumorigenesis in mice and humans through insulin-like growth factor 2 and ?-catenin.
22770937 IGF2BP2 and IGF2 genetic effects in diabetes and diabetic nephropathy.
22684773 2012 Inhibition of autocrine IGF-II on effect of human HepG2 cell proliferation and angiogenesis factor expression.
22679513 2012 Methylation defect in imprinted genes detected in patients with an Albright's hereditary osteodystrophy like phenotype and platelet Gs hypofunction.
22666415 2012 Prenatal famine and genetic variation are independently and additively associated with DNA methylation at regulatory loci within IGF2/H19.
22662119 2012 Risk factors for breast cancer and expression of insulin-like growth factor-2 (IGF-2) in women with breast cancer in Wuhan City, China.
22646060 2012 IGF2/H19 hypomethylation in a patient with very low birthweight, preocious pubarche and insulin resistance.
22630333 2012 The pregnancy-associated plasma protein A and insulin-like growth factor system in response to cigarette smoking.
22571677 2012 Influence of vascular endothelial growth factor on the expression of insulin-like growth factor-II, insulin-like growth factor binding protein-2 and 5 in human luteinized granulosa cells.
22565227 2012 Genetic variants in IGF-I, IGF-II, IGFBP-3, and adiponectin genes and colon cancer risk in African Americans and Whites.
22527168 2012 A cross-sectional analysis of the association between diet and insulin-like growth factor (IGF)-I, IGF-II, IGF-binding protein (IGFBP)-2, and IGFBP-3 in men in the United Kingdom.
22486985 2012 Insulin-like growth factor-II and heparin are anti-apoptotic survival factors in human villous cytotrophoblast.
22479380 2012 Genetic and non-genetic influences during pregnancy on infant global and site specific DNA methylation: role for folate gene variants and vitamin B12.
22447362 2012 Insulin-like growth factor 2 hypomethylation of blood leukocyte DNA is associated with gastric cancer risk.
22434232 2012 Effects of oxidative stress on intestinal type I insulin-like growth factor receptor expression.
22399759 2012 Gene expression profiling of neural stem cells and their neuronal progeny reveals IGF2 as a regulator of adult hippocampal neurogenesis.
22395465 2012 Epigenetic and genetic variation at the IGF2/H19 imprinting control region on 11p15.5 is associated with cerebellum weight.
22392079 2012 Association of cord blood methylation fractions at imprinted insulin-like growth factor 2 (IGF2), plasma IGF2, and birth weight.
22377707 2012 IGF2R genetic variants, circulating IGF2 concentrations and colon cancer risk in African Americans and Whites.
22372631 2012 Does insulin-like growth factor 1 receptor (IGF-1R) targeting provide new treatment options for chordomas? A retrospective clinical and immunohistochemical study.
22347413 2012 Smoking, green tea consumption, genetic polymorphisms in the insulin-like growth factors and lung cancer risk.
22341586 2012 Insulin-like growth factor 2/H19 methylation at birth and risk of overweight and obesity in children.
22309801 2012 The relationship between polycystic ovary syndrome, glucose tolerance status and serum preptin level.
22253890 2012 Associations of insulin and insulin-like growth factors with physical performance in old age in the Boyd Orr and Caerphilly studies.
22253814 2012 A multi-cohort study of polymorphisms in the GH/IGF axis and physical capability: the HALCyon programme.
22248018 2012 Increased incidence of aberrant DNA methylation within diverse imprinted gene loci outside of IGF2/H19 in Silver-Russell syndrome.
22245250 2012 The retinoic acid-induced up-regulation of insulin-like growth factor 1 and 2 is associated with prolidase-dependent collagen synthesis in UVA-irradiated human dermal equivalents.
22242132 2011 Effects of cord serum insulin, IGF-II, IGFBP-2, IL-6 and cortisol concentrations on human birth weight and length: pilot study.
22189999 2012 Characterisation of adiponectin multimers and the IGF axis in humans with a heterozygote mutation in the tyrosine kinase domain of the insulin receptor gene.
22188815 2012 Potent inhibition of angiogenesis by the IGF-1 receptor-targeting antibody SCH717454 is reversed by IGF-2.
22171320 2012 Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD.
22140443 2011 Understanding the mechanism of insulin and insulin-like growth factor (IGF) receptor activation by IGF-II.
22121898 2010 Specific hypomethylated CpGs at the IGF2 locus act as an epigenetic biomarker for familial adenomatous polyposis colorectal cancer.
22098246 2012 Single nucleotide polymorphisms associated with metastatic tumour antigen 1 overexpression in patients with hepatocellular carcinoma.
22082268 2011 Influence of placental mannose/n-acetyl glucosamine-binding proteins on the interaction of insulin and insulin-like growth factors with their receptors.
22069105 2011 Increased risk of type 1 diabetes in Polish children - association with INS-IGF2 5'VNTR and lack of association with HLA haplotype.
22042095 2012 The distribution of IGF2 and IMP3 in osteosarcoma and its relationship with angiogenesis.
21926269 2011 Associations between paternally transmitted fetal IGF2 variants and maternal circulating glucose concentrations in pregnancy.
21889930 2012 Changes in serum obestatin, preptin and ghrelins in patients with Gestational Diabetes Mellitus.
21880216 A systems biology approach: new insights into fetal growth restriction using Bayesian Networks.
21852217 2012 Insulin-like growth factor axis gene polymorphisms modify risk of pancreatic cancer.
21829393 2011 Genome-wide association analysis of autoantibody positivity in type 1 diabetes cases.
21823995 2011 Gene expression patterns of insulin-like growth factor 1, insulin-like growth factor 2 and insulin-like growth factor binding protein 3 in human placenta from pregnancies with intrauterine growth restriction.
21805044 2011 Loss of imprinting and aberrant methylation of IGF2 in placentas from pregnancies complicated with fetal growth restriction.
21798010 2011 Liver mitochondrial dysfunction is reverted by insulin-like growth factor II (IGF-II) in aging rats.
21761181 2012 The molecular basis of IGF-II/IGF2R recognition: a combined molecular dynamics simulation, free-energy calculation and computational alanine scanning study.
21757716 2011 RNA-binding protein insulin-like growth factor mRNA-binding protein 3 (IMP-3) promotes cell survival via insulin-like growth factor II signaling after ionizing radiation.
21744995 2011 Rhabdomyosarcoma: molecular analysis of Igf2, MyoD1 and Myogenin expression.
21733157 2011 Hepatoprotection and neuroprotection induced by low doses of IGF-II in aging rats.
21708937 2011 Genetic variation in IGF2 and HTRA1 and breast cancer risk among BRCA1 and BRCA2 carriers.
21704210 2011 DNA methylation at H19/IGF2 ICR1 in the placenta of pregnancies conceived by in vitro fertilization and intracytoplasmic sperm injection.
21672538 2011 IGF2 derived from SH-SY5Y neuroblastoma cells induces the osteoclastogenesis of human monocytic precursors.
21668571 2012 Immunohistochemical evaluation of p53, FHIT, and IGF2 gene expression in esophageal cancer.
21636975 2011 Methylation variation at IGF2 differentially methylated regions and maternal folic acid use before and during pregnancy.
21613208 2011 Insulin growth factor-2 binding protein 3 (IGF2BP3) is a glioblastoma-specific marker that activates phosphatidylinositol 3-kinase/mitogen-activated protein kinase (PI3K/MAPK) pathways by modulating IGF-2.
21576258 2011 mTOR phosphorylates IMP2 to promote IGF2 mRNA translation by internal ribosomal entry.
21548981 2011 Serine 204 phosphorylation and O-?-GlcNAC interplay of IGFBP-6 as therapeutic indicator to regulate IGF-II functions in viral mediated hepatocellular carcinoma.
21536749 2011 Interruption of intrachromosomal looping by CCCTC binding factor decoy proteins abrogates genomic imprinting of human insulin-like growth factor II.
21535266 2011 Insulin-like growth factor 2 enhances insulinogenic differentiation of human eyelid adipose stem cells via the insulin receptor.
21506705 2011 Expression of insulin-like growth factor-II, matrix metalloproteinases, and their tissue inhibitors as predictive markers in the peripheral blood of HCC patients.
21432864 2011 Insulin-like growth factor-2 (IGF2) loss of imprinting marks a field defect within human prostates containing cancer.
21410323 2011 Insulin-like growth factor-2 (IGF-2) activates estrogen receptor-? and -? via the IGF-1 and the insulin receptors in breast cancer cells.
21380782 2012 The correlation between IGF-II and Bcl-2 expression in colorectal adenocarcinoma.
21282187 2011 Disruption of genomic neighbourhood at the imprinted IGF2-H19 locus in Beckwith-Wiedemann syndrome and Silver-Russell syndrome.
21278389 2011 Deletions and rearrangements of the H19/IGF2 enhancer region in patients with Silver-Russell syndrome and growth retardation.
21268128 2011 Loss of imprinting and abnormal expression of the insulin-like growth factor 2 gene in gastric cancer.
21251749 2011 Association between endometriosis and polymorphisms in insulin-like growth factors (IGFs) and IGF-I receptor genes in Korean women.
21238444 2011 IGF-II and MMP9 as surgical repair indicators of ventricular septal defects.
21164426 2011 Maternal serum and cord blood preptin levels in gestational diabetes mellitus.
21109978 2011 IGF-II promoter specific methylation and expression in epithelial ovarian cancer and their associations with disease characteristics.
21078522 2011 Common genetic variation within IGFI, IGFII, IGFBP-1, and IGFBP-3 and endometrial cancer risk.
20945273 2010 Cervical scrapes levels of insulin-like growth factor-II and insulin-like growth factor binding protein 3 in women with squamous intraepithelial lesions and cervical cancer.
20937833 2010 Long range interactions regulate Igf2 gene transcription during skeletal muscle differentiation.
20929508 2009 Relevance of insulin-like growth factor 2 in the etiopathophysiology of diabetic nephropathy: possible roles of phosphatase and tensin homolog on chromosome 10 and secreted protein acidic and rich in cysteine as regulators of repair.
20884247 Effect of the somatostatin analog octreotide acetate on circulating insulin-like growth factor-1 and related peptides in patients with non-metastatic castration-resistant prostate cancer: results of a phase II study.
20861572 2010 Genomic imprinting status of IGF-II and H19 in placentas of fetal growth restriction patients.
20842449 2011 Down-regulation of achaete-scute complex homolog 1 (ASCL1) in neuroblastoma cells induces up-regulation of insulin-like growth factor 2 (IGF2).
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20709701 2010 Large solitary fibrous tumor with overexpression of insulin-like growth factor-2.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20661447 2010 Inter- and intra-individual variation in allele-specific DNA methylation and gene expression in children conceived using assisted reproductive technology.
20651370 2010 Insulin-like growth factors II exon 9 and E-cadherin-Pml I but not myeloperoxidase promoter-463, urokinase-ApaL I nor xeroderma pigmentosum polymorphisms are associated with higher susceptibility to leiomyoma.
20639793 2010 Association of birth weight with polymorphisms in the IGF2, H19, and IGF2R genes.
20637510 2010 Glatiramer acetate-reactive T lymphocytes regulate oligodendrocyte progenitor cell number in vitro: role of IGF-2.
20634197 2010 Comprehensive analysis of common genetic variation in 61 genes related to steroid hormone and insulin-like growth factor-I metabolism and breast cancer risk in the NCI breast and prostate cancer cohort consortium.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20592487 2010 Targeted tumor gene therapy based on loss of IGF2 imprinting.
20564319 2010 Prostate cancer risk-associated variants reported from genome-wide association studies: meta-analysis and their contribution to genetic Variation.
20540659 2010 Maternal insulin-like growth factors 1 and 2 (IGF-1, IGF-2) and IGF BP-3 and the hypertensive disorders of pregnancy.
20484977 2010 Gene expression pattern of IGF2, PHLDA2, PEG10 and CDKN1C imprinted genes in spontaneous miscarriages or fetal deaths.
20483645 2010 Investigation of IGF2/ApaI and H19/RsaI polymorphisms in patients with cutaneous melanoma.
20479215 2010 Expression of an ASCL2 related stem cell signature and IGF2 in colorectal cancer liver metastases with 11p15.5 gain.
20472480 2010 Brief, high intensity exercise alters serum ghrelin and growth hormone concentrations but not IGF-I, IGF-II or IGF-I bioactivity.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20443017 2010 Upregulation of IGF2 is associated with an acquired resistance for cis-diamminedichloroplatinum in human head and neck squamous cell carcinoma.
20427254 2010 Relationship between serum levels of insulin-like growth factors and subsequent risk of cancer mortality: findings from a nested case-control study within the Japan Collaborative Cohort Study.
20422427 2011 Regulation of IGF2 transcript and protein expression by altered methylation in breast cancer.
20418667 2010 Epigenetic modulation of the IGF2/H19 imprinted domain in human embryonic and extra-embryonic compartments and its possible role in fetal growth restriction.
20416304 2010 Insulin-like growth factor axis gene polymorphisms and clinical outcomes in pancreatic cancer.
20403997 2010 Genetic variation in 3-hydroxy-3-methylglutaryl CoA reductase modifies the chemopreventive activity of statins for colorectal cancer.
20403354 2010 A population-based study of IGF axis polymorphisms and the esophageal inflammation, metaplasia, adenocarcinoma sequence.
20388800 2010 Oncogenic role of miR-483-3p at the IGF2/483 locus.
20364576 2010 [Epigenetic activation of IGF2 during cellular senescence].
20338046 2010 DNA methylation profiling in doxorubicin treated primary locally advanced breast tumours identifies novel genes associated with survival and treatment response.
20206398 2010 IGF activation in a molecular subclass of hepatocellular carcinoma and pre-clinical efficacy of IGF-1R blockage.
20157191 2010 Plasma insulin-like growth factor-binding protein-2 levels as diagnostic and prognostic biomarker of colorectal cancer.
20119675 2010 Relationship of insulin-like growth factors system gene polymorphisms with the susceptibility and pathological development of hepatocellular carcinoma.
20089431 2010 Differential insulin-like growth factor II (IGF-II) expression: A potential role for breast cancer survival disparity.
20057340 2010 IGF2 gene variants and risk of hypertension in obese children and adolescents.
20042264 2010 Expression of the imprinted IGF2 and H19 genes in the endometrium of cases with unexplained infertility.
20027339 2009 Endostatin, placental growth factor, and fibroblast growth factors-1 and -2 in the sera of patients with primary osteosarcomas.
20010889 2010 Brain weight in males is correlated with DNA methylation at IGF2.
20007505 2010 Analysis of the IGF2/H19 imprinting control region uncovers new genetic defects, including mutations of OCT-binding sequences, in patients with 11p15 fetal growth disorders.
19962924 2010 Mature IGF-II prevents the formation of "big" IGF-II/IGFBP-2 complex in the human circulation.
19957330 2010 Loss of imprinting and marked gene elevation are 2 forms of aberrant IGF2 expression in colorectal cancer.
19956846 2010 Frequent aberrant methylation of the imprinted IGF2/H19 locus and LINE1 hypomethylation in ovarian carcinoma.
19956766 2009 Cohesin is required for higher-order chromatin conformation at the imprinted IGF2-H19 locus.
19953105 2010 Dairy intake associates with the IGF rs680 polymorphism to height variation in periadolescent children.
19950580 2009 [VIGILIN involves in regulation of imprinting gene IGF2 and H19 in human hepatocellular carcinoma cell].
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19938957 2009 Response of IGF and IL-6 to ovarian stimulation in PCOS and normal women.
19924280 2009 Periconceptional maternal folic acid use of 400 microg per day is related to increased methylation of the IGF2 gene in the very young child.
19919531 2009 bFGF enhances the IGFs-mediated pluripotent and differentiation potentials in multipotent stem cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19876004 2010 Obesity-related polymorphisms and their associations with the ability to regulate fat oxidation in obese Europeans: the NUGENOB study.
19843644 2009 Loss of imprinting of the insulin-like growth factor II (IGF2) gene in esophageal normal and adenocarcinoma tissues.
19838169 2009 Enrichment of glycopeptides for glycan structure and attachment site identification.
19786462 2010 Racial differences in the association between body mass index and serum IGF1, IGF2, and IGFBP3.
19769965 2009 CREG inhibits migration of human vascular smooth muscle cells by mediating IGF-II endocytosis.
19767753 2009 Identification of seven new prostate cancer susceptibility loci through a genome-wide association study.
19749460 High frequency of loss of allelic integrity at Wilms' tumor suppressor gene-1 locus in advanced breast tumors associated with aggressiveness of the tumor.
19737423 2009 Loss of imprinting of insulin-like growth factor 2 is associated with increased risk of lymph node metastasis and gastric corpus cancer.
19724140 2009 Crystallization and preliminary X-ray analysis of the complexes between a Fab and two forms of human insulin-like growth factor II.
19713175 2009 Levels of insulin-like growth factors and their receptors in placenta in relation to macrosomia.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19689072 2009 [Study on genomic imprinting of IGF2 in breast cancer].
19672298 2009 A novel combination of factors, termed SPIE, which promotes dopaminergic neuron differentiation from human embryonic stem cells.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19598235 2009 Genes related to sex steroids, neural growth, and social-emotional behavior are associated with autistic traits, empathy, and Asperger syndrome.
19588890 2009 Association of insulin-like growth factor 2 with the insulin-linked polymorphic region in cultured fetal thymus cells.
19586133 IGF2 is highly expressed in pediatric undifferentiated sarcomas and reveals two distinct cytoplasmic trafficking patterns.
19584898 2010 Specific epigenetic alterations of IGF2-H19 locus in spermatozoa from infertile men.
19560381 2009 Evaluation of IGF-2/ApaI polymorphism in pregnant women infected with human immunodeficiency virus type 1 taking antiretroviral drugs.
19549920 2009 Insulin-like growth factor-II methylation status in lymphocyte DNA and colon cancer risk in the Northern Sweden Health and Disease cohort.
19546867 2009 Parent-of-origin specific linkage and association of the IGF2 gene region with birth weight and adult metabolic risk factors.
19513555 2009 Aberrant epigenetic modifications in the CTCF binding domain of the IGF2/H19 gene in prostate cancer compared with benign prostate hyperplasia.
19502451 2009 Hypermethylation of the IGF2 differentially methylated region 2 is a specific event in insulinomas leading to loss-of-imprinting and overexpression.
19499149 2009 Homocysteine harasses the imprinting expression of IGF2 and H19 by demethylation of differentially methylated region between IGF2/H19 genes.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19427670 2009 Hypomethylation of the P3 promoter is associated with up-regulation of IGF2 expression in human osteosarcoma.
19421925 2009 [Combined analyses of paraoxonase-1 and IGF-2 polymorphism in polycystic ovary syndrome].
19417744 2009 Insulin-like growth factor levels in cord blood, birth weight and breast cancer risk.
19407853 2009 Expression of insulin-like growth factor 2 in mesenchymal neoplasms.
19390492 2009 Paternal allele of IGF2 gene haplotype CTG is associated with fetal and placental growth in Japanese.
19367319 2009 Human longevity and 11p15.5: a study in 1321 centenarians.
19365888 Tissue markers of hypoglycemia: insulin growth factor-II and E-domain of proinsulin growth factor-II expression in solitary fibrous tumor of the pleura.
19336370 2009 Determination of genetic predisposition to patent ductus arteriosus in preterm infants.
19333718 2010 Connective tissue growth factor is a downstream mediator for preptin-induced proliferation and differentiation in human osteoblasts.
19317253 2009 The up-regulation of KCC1 gene expression in cervical cancer cells by IGF-II through the ERK1/2MAPK and PI3K/AKT pathways and its significance.
19293570 2009 Inherited and Sporadic Epimutations at the IGF2-H19 locus in Beckwith-Wiedemann syndrome and Wilms' tumor.
19276395 2009 Insulin-like growth factors and insulin-like growth factor-binding proteins in relation to disease status and incidence of hypoglycaemia in patients with a gastrointestinal stromal tumour.
19259766 2010 A case of a giant phyllodes tumor of the breast with hypoglycemia caused by high-molecular-weight insulin-like growth factor II.
19242102 2009 Temporal stability and age-related prevalence of loss of imprinting of the insulin-like growth factor-2 gene.
19218281 2009 Microarray gene expression and immunohistochemistry analyses of adrenocortical tumors identify IGF2 and Ki-67 as useful in differentiating carcinomas from adenomas.
19208780 2009 Structure and function of the human Gly1619Arg polymorphism of M6P/IGF2R domain 11 implicated in IGF2 dependent growth.
19207313 2009 IGF system in children with congenital disorders of glycosylation.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19127217 2009 Effects of different CMV-heat-inactivation-methods on growth factors in human breast milk.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
19121847 2009 Diagnostic and prognostic role of the insulin growth factor pathway members insulin-like growth factor-II and insulin-like growth factor binding protein-3 in serous effusions.
19066168 2009 Epigenetic mutations of the imprinted IGF2-H19 domain in Silver-Russell syndrome (SRS): results from a large cohort of patients with SRS and SRS-like phenotypes.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
19064563 2008 Effect of insulin-like growth factor gene polymorphisms alone or in interaction with diabetes on the risk of pancreatic cancer.
19034281 2008 Loss of imprinting of IGF2 correlates with hypermethylation of the H19 differentially methylated region in hepatoblastoma.
18980977 2008 Recurrence of urothelial carcinoma of the bladder: a role for insulin-like growth factor-II loss of imprinting and cytoplasmic E-cadherin immunolocalization.
18955703 2008 Persistent epigenetic differences associated with prenatal exposure to famine in humans.
18931647 2009 Hyperinsulinemic hypoglycemia with nesidioblastosis: histologic features and growth factor expression.
18832656 2009 Endothelial progenitor cell homing: prominent role of the IGF2-IGF2R-PLCbeta2 axis.
18803353 2008 Liver insulin-like growth factor 2 methylation in hepatitis C virus cirrhosis and further occurrence of hepatocellular carcinoma.
18794369 2008 A novel H19 antisense RNA overexpressed in breast cancer contributes to paternal IGF2 expression.
18788888 Expression of insulin-like growth factor pathway proteins in rhabdomyosarcoma: IGF-2 expression is associated with translocation-negative tumors.
18786438 2008 High frequency of loss of heterozygosity at 11p15 and IGF2 overexpression are not related to clinical outcome in childhood adrenocortical tumors positive for the R337H TP53 mutation.
18772331 2008 Neuraminidase-1, a subunit of the cell surface elastin receptor, desialylates and functionally inactivates adjacent receptors interacting with the mitogenic growth factors PDGF-BB and IGF-2.
18728168 2008 Severe intrauterine growth retardation and atypical diabetes associated with a translocation breakpoint disrupting regulation of the insulin-like growth factor 2 gene.
18719053 2008 Elevated free IGF2 levels in localized, early-stage breast cancer in women.
18701505 2008 Aging and cancer-related loss of insulin-like growth factor 2 imprinting in the mouse and human prostate.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18636124 2008 Polymorphisms in the estrogen receptor 1 and vitamin C and matrix metalloproteinase gene families are associated with susceptibility to lymphoma.
18619647 2008 Genetic alterations in colorectal cancers with demethylation of insulin-like growth factor II.
18616667 2008 Insulin and insulin-like growth factor resistance in alcoholic neurodegeneration.
18611974 2008 Expression of insulin-like growth factor-II and its receptor in pediatric and adult adrenocortical tumors.
18607558 2008 Molecular and clinical findings and their correlations in Silver-Russell syndrome: implications for a positive role of IGF2 in growth determination and differential imprinting regulation of the IGF2-H19 domain in bodies and placentas.
18604514 2008 Loss of imprinting of IGF2 and H19, loss of heterozygosity of IGF2R and CTCF, and Helicobacter pylori infection in laryngeal squamous cell carcinoma.
18573128 2008 Genetic predisposition to idiopathic recurrent spontaneous abortion: contribution of genetic variations in IGF-2 and H19 imprinted genes.
18562769 2008 Genetic variation in insulin-like growth factors and brain tumor risk.
18541649 2008 Somatically acquired hypomethylation of IGF2 in breast and colorectal cancer.
18537183 2008 Autocrine insulin-like growth factor-II stimulation of tumor cell migration is a progression step in human hepatocarcinogenesis.
18524796 2008 Elevated serum levels of IGF-binding protein 2 in patients with non-seminomatous germ cell cancer: correlation with tumor markers alpha-fetoprotein and human chorionic gonadotropin.
18520331 2008 Role of IGFs and insulin in the human testis during postnatal activation: differentiation of steroidogenic cells.
18481170 2009 Peptide concentrations and mRNA expression of IGF-I, IGF-II and IGFBP-3 in breast cancer and their associations with disease characteristics.
18467708 2008 Insulin-like growth factor-II is increased in systemic sclerosis-associated pulmonary fibrosis and contributes to the fibrotic process via Jun N-terminal kinase- and phosphatidylinositol-3 kinase-dependent pathways.
18464243 2008 Duplication of paternal IGF2 or loss of maternal IGF2 imprinting occurs in half of Wilms tumors with various structural WT1 abnormalities.
18428028 2008 Precursor IGF-II (proIGF-II) and mature IGF-II (mIGF-II) induce Bcl-2 And Bcl-X L expression through different signaling pathways in breast cancer cells.
18372285 2008 Insulin-like growth factor (IGF) 1 and 2 help to predict disease outcome in GIST patients.
18358696 2008 Hypomethylated and hypermethylated profiles of H19DMR are associated with the aberrant imprinting of IGF2 and H19 in human hepatocellular carcinoma.
18350600 2008 Reactivation of the insulin-like growth factor-II signaling pathway in human hepatocellular carcinoma.
18349294 2008 Risk of testicular germ cell tumors and polymorphisms in the insulin-like growth factor genes.
18308616 2008 IGF2: epigenetic regulation and role in development and disease.
18297687 2008 Vitamin C suppresses proliferation of the human melanoma cell SK-MEL-2 through the inhibition of cyclooxygenase-2 (COX-2) expression and the modulation of insulin-like growth factor II (IGF-II) production.
18287964 2008 IGF-2 and FLT-1/VEGF-R1 mRNA levels reveal distinctions and similarities between congenital and common infantile hemangioma.
18259111 2008 Temporal changes in insulin-like growth factors I and II and in insulin-like growth factor binding proteins 1, 2, and 3 in human milk.
18245780 2008 Different mechanisms cause imprinting defects at the IGF2/H19 locus in Beckwith-Wiedemann syndrome and Wilms' tumour.
18199734 2008 IGF-I and IGF-II genetic variation and breast cancer risk in Chinese women: results from the Shanghai Breast Cancer Study.
18159214 2008 IGF2/H19 hypomethylation in Silver-Russell syndrome and isolated hemihypoplasia.
18085551 2008 Haplotype analysis of the IGF2-INS-TH gene cluster in Parkinson's disease.
18046459 2008 Structure and functional analysis of the IGF-II/IGF2R interaction.
18035699 2005 [Insulin-like growth factor (IGF)-II in human hepatocarcinogenesis--a potential therapeutic target?].
18022169 2008 Differential effects of human chorionic gonadotropin and decidualization on insulin-like growth factors-I and -II in human endometrial stromal cells.
18006818 2007 Examination of IGF2 and H19 loss of imprinting in bladder cancer.
17972051 2007 Association of gastric cancer with tyrosine hydroxylase gene polymorphism in a northwestern Chinese population.
17919721 2008 Placental IGF2 expression in normal and intrauterine growth restricted (IUGR) pregnancies.
17786320 2007 Upregulation of IGF-2 and IGF-1 receptor expression in oral cancer cell lines.
17700581 2008 Association between small for gestational age and paternally inherited 5' insulin haplotypes.
17667841 2007 Association between paternally inherited haplotypes upstream of the insulin gene and umbilical cord IGF-II levels.
17640993 2007 Rho guanosine 5'-triphosphatases differentially regulate insulin-like growth factor I (IGF-I) receptor-dependent and -independent actions of IGF-II on human trophoblast migration.
17639583 2007 Duplication of the paternal IGF2 allele in trisomy 11 and elevated expression levels of IGF2 mRNA in congenital mesoblastic nephroma of the cellular or mixed type.
17635080 2007 Associations of blood levels of insulin-like growth factor (IGF)-I, IGF-II and IGF binding protein (IGFBP)-3 in schizophrenic Arab subjects.
17632545 2007 A genome-wide association study identifies KIAA0350 as a type 1 diabetes gene.
17620336 2007 The insulin-like growth factor type 1 and insulin-like growth factor type 2/mannose-6-phosphate receptors independently regulate ERK1/2 activity in HEK293 cells.
17591929 2007 Evaluation of markers for CpG island methylator phenotype (CIMP) in colorectal cancer by a large population-based sample.
17569086 2007 IGF-II promoter methylation and ovarian cancer prognosis.
17560154 2007 Severe deficiencies of IGF-I, IGF-II, IGFBP-3, ALS and paradoxically high-normal bone mass in a child with insulin-resistance syndrome (Rabson-Mendenhall type).
17556377 2007 IGF-II regulates metastatic properties of choriocarcinoma cells through the activation of the insulin receptor.
17554260 2007 Robust associations of four new chromosome regions from genome-wide analyses of type 1 diabetes.
17488802 2007 Study of association between common variation in the insulin-like growth factor 2 gene and indices of obesity and body size in middle-aged men and women.
17475626 2007 A novel binding site for the human insulin-like growth factor-II (IGF-II)/mannose 6-phosphate receptor on IGF-II.
17440932 2007 Anorexia nervosa, perfectionism, and dopamine D4 receptor (DRD4).
17407457 2007 Insulin-like growth factor 2 (IGF2) and IGF2 receptor gene variants are associated with fetal growth.
17369847 2007 IGF-II and IGFBP-2 differentially regulate PTEN in human breast cancer cells.
17360667 2007 Identification of IGF2 signaling through phosphoinositide-3-kinase regulatory subunit 3 as a growth-promoting axis in glioblastoma.
17341887 2007 Insulin-like growth factors and binding proteins in early milk from mothers of preterm and term infants.
17339271 2007 Heritable rather than age-related environmental and stochastic factors dominate variation in DNA methylation of the human IGF2/H19 locus.
17325026 2007 Paternally inherited submicroscopic duplication at 11p15.5 implicates insulin-like growth factor II in overgrowth and Wilms' tumorigenesis.
17310846 2006 LOI of IGF2 is associated with esophageal cancer and linked to methylation status of IGF2 DMR.
17294726 2007 [The aberrant imprinting of insulin-like growth factor II and H19 in human hepatocellular carcinoma].
17289909 2007 IGF-II gene region polymorphisms related to exertional muscle damage.
17285535 2007 [Loss of imprinting of IGF2 in cord blood of newborns of Chinese Han population].
17072986 2006 Signaling pathway of insulin-like growth factor-II as a target of molecular therapy for hepatoblastoma.
17029194 2006 [Characteristics of IGF-II gene imprinting in twin placentas].
16935391 2006 The prognostic significance of pretreatment plasma levels of insulin-like growth factor (IGF)-1, IGF-2, and IGF binding protein-3 in patients with advanced non-small cell lung cancer.
16926156 2006 Insulin-like growth factors mediate heterotrimeric G protein-dependent ERK1/2 activation by transactivating sphingosine 1-phosphate receptors.
16912056 2007 Preptin, another peptide product of the pancreatic beta-cell, is osteogenic in vitro and in vivo.
16888814 2007 Insulin-like growth factors induce apoptosis as well as proliferation in LIM 1215 colon cancer cells.
16868148 2006 The ACAA-insertion/deletion polymorphism at the 3' UTR of the IGF-II receptor gene is associated with type 2 diabetes and surrogate markers of insulin resistance.
16857788 2006 Hypomethylated P4 promoter induces expression of the insulin-like growth factor-II gene in hepatocellular carcinoma in a Chinese population.
16750516 2006 IGF2 polymorphisms are associated with hepatitis B virus clearance and hepatocellular carcinoma.
16716263 2006 IGF-I and IGF-II stimulate directed cell migration of bone-marrow-derived human mesenchymal progenitor cells.
16612114 2006 Imprinted genes, placental development and fetal growth.
16603642 2006 Frequent IGF2/H19 domain epigenetic alterations and elevated IGF2 expression in epithelial ovarian cancer.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16531418 2006 Imprinting of IGF2 P0 transcript and novel alternatively spliced INS-IGF2 isoforms show differences between mouse and human.
16525660 2006 Loss of imprinting in IGF2 in colorectal carcinoma assessed by microdissection.
16518847 2006 Association of 11q loss, trisomy 12, and possible 16q loss with loss of imprinting of insulin-like growth factor-II in Wilms tumor.
16489075 2006 The relationship of insulin-like growth factor-II, insulin-like growth factor binding protein-3, and estrogen receptor-alpha expression to disease progression in epithelial ovarian cancer.
16344718 2006 A study of TH01 and IGF2-INS-TH haplotypes in relation to smoking initiation in three independent surveys.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16330588 2005 Association between the insulin-like growth factor 2 gene (IGF2) and scores on the Eating Attitudes Test in nonclinical subjects: a family-based study.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
16251897 2006 Replication of IGF2-INS-TH*5 haplotype effect on obesity in older men and study of related phenotypes.
16247461 2006 IGF2 is critical for tumorigenesis by synovial sarcoma oncoprotein SYT-SSX1.
16166779 2005 Single-nucleotide polymorphisms and haplotype LD analysis of the 29-kb IGF2 region on chromosome 11p15.5 in the Korean population.
16115888 2005 Pregnancy-associated plasma protein-A regulates myoblast proliferation and differentiation through an insulin-like growth factor-dependent mechanism.
16102992 2005 Association between birth weight, body mass index and IGF2/ApaI polymorphism.
16040806 2005 Role of pro-IGF-II processing by proprotein convertase 4 in human placental development.
16037384 2005 Resveratrol regulates insulin-like growth factor-II in breast cancer cells.
16018936 Glutathione S-transferase M1 gene but not insulin-like growth factor-2 gene or epidermal growth factor gene is associated with prostate cancer.
15987847 2005 Insulin-like growth factor II and binding proteins 1 and 3 from second trimester human amniotic fluid are associated with infant birth weight.
15970649 Polymorphism in IGF-2 as a surrogate marker for predisposition towards tobacco chewing-mediated oral cancer.
15956340 2005 Interaction of insulin-like growth factor (IGF)-I and -II with IGF binding protein-2: mapping the binding surfaces by nuclear magnetic resonance.
15954927 2005 Skeletal muscle mRNA for IGF-IEa, IGF-II, and IGF-I receptor is decreased in sedentary chronic hemodialysis patients.
15935984 2005 Interleukin-5 potentiates the growth response of Caco-2 cells to IGF-II: a role in colonic carcinogenesis complicating ulcerative colitis?
15809062 2005 Impact of PTEN on the expression of insulin-like growth factors (IGFs) and IGF-binding proteins in human gastric adenocarcinoma cells.
15799974 2005 Domain interactions of the mannose 6-phosphate/insulin-like growth factor II receptor.
15797461 2005 Insulin-like growth factor signaling in fish.
15769738 2005 CRD-BP/IMP1 expression characterizes cord blood CD34+ stem cells and affects c-myc and IGF-II expression in MCF-7 cancer cells.
15731405 2005 Loss of imprinting of Igf2 alters intestinal maturation and tumorigenesis in mice.
15706404 Genomic imprinting of IGF2 is maintained in infantile hemangioma despite its high level of expression.
15701574 2005 Overexpression of mature insulin-like growth factor (IGF)-II leads to growth arrest in Caco-2 human colon cancer cells.
15694994 2005 Effects of insulin-like growth factors and insulin-like growth factor binding protein-2 on the in vitro proliferation of peripheral blood mononuclear cells.
15645136 2005 Down-regulation of the IGF-2/H19 locus during normal and malignant hematopoiesis is independent of the imprinting pattern.
15642732 2005 Interaction of insulin-like growth factor II (IGF-II) with multiple plasma proteins: high affinity binding of plasminogen to IGF-II and IGF-binding protein-3.
15621215 2005 Candidate genes associated with ageing and life expectancy in the Jerusalem longitudinal study.
15528386 2004 Identification of selective basophil chemoattractants in human nasal polyps as insulin-like growth factor-1 and insulin-like growth factor-2.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15471867 2004 A loss of insulin-like growth factor-2 imprinting is modulated by CCCTC-binding factor down-regulation at senescence in human epithelial cells.
15359740 Quantitative mass spectrometric immunoassay of insulin like growth factor 1.
15355996 2004 Targeted knockdown of the RNA-binding protein CRD-BP promotes cell proliferation via an insulin-like growth factor II-dependent pathway in human K562 leukemia cells.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15298990 2004 Insulin-like growth factor-2 genotype, fat-free mass, and muscle performance across the adult life span.
15217931 2004 Insulin-like growth factor (IGF)-I and IGF-II serum concentrations in patients with benign and malignant breast lesions: free IGF-II is correlated with breast cancer size.
15205474 2004 Structural determinants for high-affinity binding of insulin-like growth factor II to insulin receptor (IR)-A, the exon 11 minus isoform of the IR.
15191555 2004 Insulin-like growth factor-II regulates the expression of vascular endothelial growth factor by the human keratinocyte cell line HaCaT.
15181035 2004 Association of the polycystic ovary syndrome with genomic variants related to insulin resistance, type 2 diabetes mellitus, and obesity.
15163116 2004 The relationship between insulin-like growth factor-II gene Apa I polymorphism and rheumatoid arthritis.
15140223 2004 Insulin-like growth factors (IGF) and IGF-binding proteins bound to vitronectin enhance keratinocyte protein synthesis and migration.
15003992 2004 Combinatorial signaling pathways determine fibroblast proliferation and myofibroblast differentiation.
14996863 2004 Loss of insulin-like growth factor-II imprinting and the presence of screen-detected colorectal adenomas in women.
14764950 2004 Longitudinal data for intrauterine levels of fetal IGF-I and IGF-II.
14749349 2004 Haplotypic analyses of the IGF2-INS-TH gene cluster in relation to cardiovascular risk traits.
14749262 2004 Genetic factors and insulin secretion: gene variants in the IGF genes.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
14710345 Adaptations of the IGF system during malignancy: human skeletal muscle versus the systemic environment.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14695992 2004 Amplification and overexpression of the IGF2 regulator PLAG1 in hepatoblastoma.
14645508 2003 Genomic imprinting controls matrix attachment regions in the Igf2 gene.
14645199 2004 An association between variants in the IGF2 gene and Beckwith-Wiedemann syndrome: interaction between genotype and epigenotype.
14614750 2003 Insulin-like growth factor-II gene polymorphism is associated with primary open angle glaucoma.
13679437 2003 Genetic and genetic expression analyses of clear cell sarcoma of the kidney.
12881524 2003 Differential gene expression induced by insulin and insulin-like growth factor-II through the insulin receptor isoform A.
12804776 2003 PTEN modulates insulin-like growth factor II (IGF-II)-mediated signaling; the protein phosphatase activity of PTEN downregulates IGF-II expression in hepatoma cells.
12782403 2003 Activation of insulin-like growth factor II signaling by mutant type p53: physiological implications for potentiation of IGF-II signaling by p53 mutant 249.
12765950 2003 Low circulating IGF-II concentrations predict weight gain and obesity in humans.
12732844 2003 A study to survey susceptible genetic factors responsible for troglitazone-associated hepatotoxicity in Japanese patients with type 2 diabetes mellitus.
12727212 2003 In vivo processed fragments of IGF binding protein-2 copurified with bioactive IGF-II.
12719950 2003 Vascular endothelial growth factor gene polymorphism is associated with calcium oxalate stone disease.
12702581 2003 Loss of imprinting of IGF2 sense and antisense transcripts in Wilms' tumor.
12700030 2003 The insulin-like growth factor/insulin system in epithelial ovarian cancer.
12637750 2003 Loss of IGF2 imprinting: a potential marker of colorectal cancer risk.
12610512 2003 Polymorphism of the insulin gene is associated with increased prostate cancer risk.
12605037 2003 Relaxation of imprinting of IGFII gene in juvenile nasopharyngeal angiofibromas.
12586351 2003 Detection of bound and free IGF-1 and IGF-2 in human plasma via biomolecular interaction analysis mass spectrometry.
12579496 2003 [The expression and imprinting status of insulin-like growth factor 2 gene in colorectal cancer].
12575534 [Morphological, cytogenetic and molecular biological characteristics of lung cancer in persons exposed for a long time to radionuclide radiation pollution in the Semipalatinsk region of Kazakhstan].
12558805 2003 Immunohistochemical localization of insulin-like growth factor-II and its binding protein-6 in human epithelial cells of Malassez.
12548223 2003 Relaxin causes proliferation of human amniotic epithelium by stimulation of insulin-like growth factor-II.
12532445 2003 Expression of IGF-II in early experimental hepatocellular carcinomas and its significance in early diagnosis.
12519841 2003 Free and total insulin-like growth factor (IGF)-I, -II, and IGF binding protein-1, -2, and -3 serum levels in patients with active thyroid eye disease.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12446294 2002 Polymorphism of the IGF2 gene, birth weight and grip strength in adult men.
12388463 2002 IGF alters jejunal glucose transporter expression and serum glucose levels in immature rats.
12270940 2003 Imprint control element-mediated secondary methylation imprints at the Igf2/H19 locus.
12243757 2002 Telomerase rescues the expression levels of keratinocyte growth factor and insulin-like growth factor-II in senescent human fibroblasts.
12138094 2002 Insulin/insulin-like growth factor I hybrid receptors have different biological characteristics depending on the insulin receptor isoform involved.
12127559 2002 Expression of insulin-like growth factors IGF-I and IGF-II, and their receptors during the growth and megakaryocytic differentiation of K562 cells.
12125963 2002 Expression of IGF-II, IGFBP-2, -5, and -6 in meningiomas with different brain invasiveness.
12006706 2002 Insulin-like growth factors and insulin-like growth factor binding proteins in adult patients with severe liver disease before and after orthotopic liver transplantation.
12005306 2002 Expression of insulin-like growth factor (IGF), IGF receptor, and IGF-binding protein messenger ribonucleic acids in luteinized granulosa cells from different size follicles after controlled ovarian hyperstimulation.
11969341 2002 The regional expression of insulin-like growth factor II (IGF-II) and insulin-like growth factor binding protein-1 (IGFBP-1) in the placentae of women with pre-eclampsia.
11937266 2002 Loss of genomic imprinting of insulin-like growth factor 2 is strongly associated with cellular proliferation in normal hematopoietic cells.
11889182 2002 Association of H19 promoter methylation with the expression of H19 and IGF-II genes in adrenocortical tumors.
11811790 2001 Contribution of residues A54 and L55 of the human insulin-like growth factor-II (IGF-II) A domain to Type 2 IGF receptor binding specificity.
11793026 2001 Insulin-like growth factor 2 (IGF2 ) and IGF-binding protein 1 (IGFBP1) gene variants are associated with overfeeding-induced metabolic changes.
11522816 2001 Kinetics and regulation of site-specific endonucleolytic cleavage of human IGF-II mRNAs.
11500939 2001 Regulation of the Akt/Glycogen synthase kinase-3 axis by insulin-like growth factor-II via activation of the human insulin receptor isoform-A.
11448941 2001 Positive associations between single nucleotide polymorphisms in the IGF2 gene region and body mass index in adult males.
11049980 2000 Imprinting of insulin-like growth factor 2 is modulated during hematopoiesis.
10884343 2000 Distinct RNA structural domains cooperate to maintain a specific cleavage site in the 3'-UTR of IGF-II mRNAs.
10810289 2000 Binding characteristics of pro-insulin-like growth factor-II from cancer patients: binary and ternary complex formation with IGF binding proteins-1 to -6.
10731720 2000 Expression and imprinting status of human PEG8/IGF2AS, a paternally expressed antisense transcript from the IGF2 locus, in Wilms' tumors.
10611375 1999 Insulin-like growth factor binding protein 2 is a growth inhibitory protein conserved in zebrafish.
10512690 1999 Inflammation-related neutrophil proteases, cathepsin G and elastase, function as insulin-like growth factor binding protein proteases.
10407151 1999 Biosensor measurement of the interaction kinetics between insulin-like growth factors and their binding proteins.
10342887 1999 Identification of vitronectin as a novel insulin-like growth factor-II binding protein.
10336724 1999 Characterization of the insulin-like growth factor axis in the human thymus.
10084601 1999 Binding properties and distribution of insulin-like growth factor binding protein-related protein 3 (IGFBP-rP3/NovH), an additional member of the IGFBP Superfamily.
9972281 1998 Insulin-like growth factor-I receptor signal transduction: at the interface between physiology and cell biology.
9722981 1998 Insulin-like growth factor II (IGF-II).
9722589 1998 Structure-function analysis of the human insulin-like growth factor binding protein-4.
9497324 1998 Insulin-like growth factor (IGF)-binding protein 5 forms an alternative ternary complex with IGFs and the acid-labile subunit.
9144427 1997 Promoter-dependent tissue-specific expressive nature of imprinting gene, insulin-like growth factor II, in human tissues.
8968759 1996 Imprinting mutation in the Beckwith-Wiedemann syndrome leads to biallelic IGF2 expression through an H19-independent pathway.
8939990 1996 Synthesis and characterization of insulin-like growth factor-binding protein (IGFBP)-7. Recombinant human mac25 protein specifically binds IGF-I and -II.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8781553 1996 Measurement of insulin-like growth factor (IGF)-II binding to purified IGF binding proteins 1-6: comparison of charcoal adsorption and high performance size exclusion chromatography.
8589713 1996 Mutations in GPC3, a glypican gene, cause the Simpson-Golabi-Behmel overgrowth syndrome.
8547330 1995 The human insulin-like growth factor II leader 1 contains an internal ribosomal entry site.
8424751 1993 Structural analysis of the human insulin-like growth factor-II P3 promoter.
8385745 1993 Relaxation of imprinted genes in human cancer.
8298652 1993 Constitutional relaxation of insulin-like growth factor II gene imprinting associated with Wilms' tumour and gigantism.
7797478 1995 Localization of the insulin-like growth factor II binding site to amino acids 1508-1566 in repeat 11 of the mannose 6-phosphate/insulin-like growth factor II receptor.
7730145 1995 Isolation of a cDNA for a growth factor of vascular endothelial cells from human lung cancer cells: its identity with insulin-like growth factor II.
7683646 1993 Binding of mutants of human insulin-like growth factor II to insulin-like growth factor binding proteins 1-6.
7680905 1993 Anatomy of the human ovarian insulin-like growth factor system.
7633596 1995 Purification and characterization of insulin-like growth factor II (IGF II) and an IGF II variant from human placenta.
7527339 1994 Solution structure of human insulin-like growth factor II; recognition sites for receptors and binding proteins.
6382022 1984 Insulin-like growth factor II precursor gene organization in relation to insulin gene family.
6382021 1984 Sequence of a cDNA clone encoding human preproinsulin-like growth factor II.
6189745 1983 Tertiary structures, receptor binding, and antigenicity of insulinlike growth factors.
3881277 1985 Nucleotide sequences of cDNAs encoding precursors of human insulin-like growth factor II (IGF-II) and an IGF-II variant.
3683205 1987 Human insulin-like growth factor I and II messenger RNA: isolation of complementary DNA and analysis of expression.
3653397 1987 A new 5'-non-coding region for human placental insulin-like growth factor II mRNA expression.
3652904 1987 Tissue-specific and developmentally regulated transcription of the insulin-like growth factor 2 gene.
3569524 1987 The human insulin-like growth factor II gene contains two development-specific promoters.
3476948 1987 Tissue-specific expression of insulin-like growth factor II mRNAs with distinct 5' untranslated regions.
3167054 1988 Differential expression of the human insulin-like growth factor II gene. Characterization of the IGF-II mRNAs and an mRNA encoding a putative IGF-II-associated protein.
3002851 1986 Organization of the human genes for insulin-like growth factors I and II.
2967174 1988 Both type I and II insulin-like growth factor receptor binding increase during lactogenesis in bovine mammary tissue.
2722836 1989 Structure and activity dependence of recombinant human insulin-like growth factor II on disulfide bond pairing.
2465304 1989 Structural and immunological comparison of insulin-like growth factor binding proteins of cerebrospinal and amniotic fluids.
2450353 1988 Isolation of an insulin-like growth factor II cDNA with a unique 5' untranslated region from human placenta.
1845984 1991 Mutants of human insulin-like growth factor II with altered affinities for the type 1 and type 2 insulin-like growth factor receptor.
1733942 1992 Comparison of the enzymatic and biochemical properties of human insulin-degrading enzyme and Escherichia coli protease III.
1730789 1992 Low-amplitude, low-frequency electric field-stimulated bone cell proliferation may in part be mediated by increased IGF-II release.
1714916 1991 Two insulin-like growth factor (IGF)-binding proteins are responsible for the selective affinity for IGF-II of cerebrospinal fluid binding proteins.
1684848 1991 Polymerase chain reaction (PCR) for detection of ApaI polymorphism at the insulin like growth factor II gene (IGF2).
1656956 1991 Specific endonucleolytic cleavage of IGF-II mRNAs.
1569071 1992 The identification of O-glycosylated precursors of insulin-like growth factor II.
1486331 1992 Structure and expression of the human insulin-like growth factor genes.
1282023 1992 The third IGF-II promoter specifies transcription of three transcripts out of five in human placenta.
658418 1978 Primary structure of human insulin-like growth factor II.