Property Summary

NCBI Gene PubMed Count 821
PubMed Score 2286.34
PubTator Score 2112.40

Knowledge Summary

Patent (286,378)

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Gout 93 0.0 2.0

Expression

  Differential Expression (25)

Disease log2 FC p
Alzheimer's disease 1.700 1.8e-02
astrocytoma 2.000 4.4e-03
ependymoma 1.300 1.9e-03
oligodendroglioma 1.700 9.6e-04
osteosarcoma 1.649 5.0e-02
atypical teratoid / rhabdoid tumor 1.400 4.8e-03
glioblastoma 1.300 1.6e-03
medulloblastoma 1.200 3.5e-02
medulloblastoma, large-cell 1.500 1.6e-04
primitive neuroectodermal tumor 1.400 2.3e-03
pancreatic ductal adenocarcinoma liver m... 1.485 3.2e-02
non-small cell lung cancer 1.263 3.8e-11
intraductal papillary-mucinous carcinoma... -1.300 2.0e-03
intraductal papillary-mucinous neoplasm ... -1.100 3.0e-03
diabetes mellitus -1.100 1.2e-02
interstitial cystitis -1.400 2.5e-04
pediatric high grade glioma 1.200 5.5e-04
pilocytic astrocytoma 1.400 7.5e-06
aldosterone-producing adenoma -1.369 3.2e-02
spina bifida -1.093 2.7e-02
Pick disease 2.400 1.2e-06
progressive supranuclear palsy 1.800 6.0e-03
Breast cancer -1.700 3.6e-04
acute myeloid leukemia -1.400 6.7e-03
ovarian cancer -1.900 7.1e-05

Protein-protein Interaction (11)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (734)

PMID Text
27172746 IGF1R expression in epithelial ovarian cancer is associated with estrogen and progesterone receptor positive status and HER2 non-amplification.
27048245 Our study demonstrates that the IGF1R/p110b/AKT/mTOR axis confers resistance to BYL719 in PIK3CA mutant breast cancers.
26991004 Full-length MGF directly stimulates the IGF-IR. Despite a higher EC50 concentration, at high equimolar concentrations full-length MGF showed a similar maximal potency to activate the IGF-IR as compared to IGF-I.
26910308 Data show that the lack of insulin like growth factor 1 receptor (IGFIR) resulted in an impaired cold acclimation.
26862994 Data indicate that a highly specific qRT-PCR assay to quantify levels of the insulin-like growth factor receptor and insulin receptor isoforms (IR-A, IR-B, and IGF-1R) on the same scale to provide a critical diagnostic and predictive tool.
26862168 IGF1R signaling was necessary for DC-mediated T-ALL survival.
26850678 Given the limited number of patients treated with KW-2450 in our study, it is not possible to make a meaningful comparison of efficacy with other IGF-1R/IR dual kinases inhibitors
26845446 MiR-133a suppresses osteosarcoma progression and metastasis by targeting IGF-1R in human osteosarcoma cell.
26826001 overexpression of the IGF-1R, and activation of GSK3beta and FOXO3a might be the molecular mechanisms underlying the development of liver cirrhosis
26801096 Anoikis resistance of oestrogen-responsive breast cancer cells depends upon IGF activation of the type I IGF receptor and PI3-kinase/Akt pathway.
26760116 Low-oxygen tension can modify the IGF-1 or IGF-2 signaling via the IGF-1R and IR in placental mesenchymal stem cells.
26745129 High expression of IGF1R is associated with breast cancer.
26738606 we found a SNP (rs2016347) in IGF1R as a potential predictive marker for chemotherapy efficacy in breast cancer patients treated with TAC
26708715 these results demonstrated that miR-217 plays a tumor suppressor role in human epithelial ovarian cancer by directly targeting IGF1R gene, suggesting a new potential therapeutic target in epithelial ovarian cancer .
26670433 progression of lung cancer in mice treated with IGF-1 was significantly increased as compared to the group treated with IGF-1+AG1024 or the control group, with the same trend mirrored in IGF-1/p-IGF-1R/IGF-1R at the protein and/or mRNA levels
26656446 MiRNA-323-5p inhibited human cerebral glioma U373 cell proliferation and promoted its apoptosis by reducing IGF-1R
26655273 IGF-1R by miR-122 down-regulation contributed to activation of RAS/RAF/ERK signaling, which was associated with sorafenib resistance in hepatocellular carcinoma.
26648141 IGF1R as a target of let7a was subsequently validated using the luciferase assay.
26584640 mTORC2 promotes rapamycin- and ligand-induced type I insulin-like growth factor receptor / insulin receptor phosphorylation.
26563994 The results suggest that severe intra-uterine growth differences (birth weight discordance >20%) are associated with methylation changes in the IGF1R gene in adulthood, independent of genetic effects
26554827 Mechanistic investigations indicated that DNp73 acted by attenuating expression of miR-885-5p, a direct regulator of the IGF1 receptor (IGF1R) responsible for stemness marker expression.
26554308 Suggest that IGF1R plays an important role in acquired drug resistance against EGFR-TKIs by inducing epithelial mesenchymal transformation in non-small cell lung cancer.
26536657 HRD1 interacted with IGF-1R and promoted its ubiquitination and degradation by the proteasome
26497996 Data suggest that temozolomide (TMZ) resistance associates with insulin like growth factor 1 (IGF-1R) activation, and that simultaneous or prior IGF-1R inhibitors (IGF-1Ri) caused less effective chemo-sensitization.
26463630 Suggest that Dual treatments targeting IGF-1R, PI3K, mTORC or MEK synergize to inhibit cell growth, induce apoptosis, and arrest cell cycle at G1 phase in MDA-MB-231 cell line.
26450156 Inhibition of IGF1-R overcomes IGFBP7-induced chemotherapy resistance in T-ALL
26438154 remarkable therapeutic window observed for BI 885578 is achieved by virtue of the distinctive pharmacokinetic properties of the compound capitalizing on the physiologic mechanism of glucose homeostasis and differential levels of IGF1R and INSR expression
26430715 IGF1R overexpression lead to an increase of cell survival and suppressed cell apoptosis, IGF1R silencing mediated by RNAi abrogate this response of NCI-H446 cells.
26342551 Low EI24 and high IGF-1R expressions in lung cancer patients.
26337161 IGF1R overexpression is considered a useful independent predictor of outcomes in Stage II/III gastric cancer after curative resection and adjuvant chemotherapy with S-1.
26311784 Reducing the IGF-1 signaling pathway exerts a neuroprotective effect in a transgenic mouse model of spinal muscular atrophy.
26304632 Polymorphisms in MAP3K3, MMP24 and IGF1R are associated with greater height and act additively on height in children of an admixed population.
26297545 Downregulation of miR-99b with concomitant upregulation of its target gene IGF-1R may over-induce the PI3K-AKT signaling pathway, leading to deregulated cell proliferation in Condyloma acuminatum.
26297026 Down-regulation of IR and IGF1R, achieved by insulin + fructose and monoclonal antibody treatments, results in decreased downstream signaling.
26291053 IGF-IR is an independent prognostic factor associated with shorter survival in glioblastoma.
26286172 Results indicate that increased IGF-1 levels after recurrent hippocampal neuronal firings might, in turn, promote seizure activity via IGF-1R-dependent mechanisms.
26252249 This study defines a clinically recognizable incomplete dominant form of SHORT syndrome, and provides relevant insights into the pathophysiological and phenotypical consequences of IGF1R mutations.
26232605 High expression of IGF1R is associated with triple negative breast cancer.
26211576 Knockdown of IGFqR inhibits colorectal cancer cell growth and decreases WNT/Beta-catenin signal pathways.
26191333 Suggest role for EphB4/IGF1R signaling in regulation proliferation/migration of breast cancer cells.
26183824 PARP regulates estradiol-mediated cell growth by controlling the ER/IGF-1R/PDZK1 axis.
26173023 Both IGF1R and ROR1 can be effectively targeted by SB modified CAR T cells.
26165226 EGFR and IGF-1R appear to be overexpressed in a subset of ampullary adenocarcinomas.
26156803 These findings suggest that miR-133a may act as a tumor suppressor and inhibited survival of hepatocellular carcinoma cells by targeting IGF-1R
26148588 Our study found that breast cancer with T2DM had a higher expression of IGF1R, and the higher IGF1R was associated with negative Her2 expression.
26138883 CAV1 expression was positively related to IGF-1R expression in human hepatocellular carcinoma tissues; CAV1 confers resistance of hepatoma cells to anoikis by activating IGF-1 pathway.
26112748 PTEN regulates IGF-1R-mediated therapy resistance in melanoma
26097570 Our results indicated that miR-139-5p acts as a tumor suppressor in non-small cell lung cancer partially via down-regulating IGF1R expression.
26089099 The authors show that decreased H19 long noncoding RNA increases microRNA let-7 activity, which in turn inhibits Igf1r expression at the post-transcriptional level, thereby contributing to reduced proliferation of endometrial stromal cells.
26082409 Absence or low expression of IGF-1R was associated with high grade- and advanced tumors. IGF-1R might be a tumor marker in Barrett's esophagus since a change in expression patterns was found in the course from normal esophageal tissue to adenocarcinoma.
26075254 These results showed that deguelin possessed antitumor effect by targeting Akt in dual axis such as EGFR and IGF1R signaling pathways and suggested that it provides an applicable therapeutic strategy for HNSCC patients.
26025408 The results demonstrate that miR-30a influences non-small cell lung cancer progression through PI3K/AKT signaling pathway by targeting IGF1R in A549 cells.
26012212 Our results suggest that the decreased expression of IGF1-R by malignant plasma cells is a prognostic factor associated with severe disease
25916750 This study suggests that IGF-1R expression could be associated with better clinical outcome in classical Hodgkin's lymphoma but is significantly associated with the expression of MET receptor.
25896444 Overall survival (OS) and disease-specific survival (DSS) were reduced in patients whose tumors contained high membrane IGF-1R.
25884514 The aberrant decreases in Ik-1 and MZF1 contribute significantly to the pathogenesis of NPM-ALK(+) T-cell lymphoma through the upregulation of IGF-IR expression.
25862373 Our results suggest that metformin is a potent inhibitor of the IGF-1/IGF-1R system and may be beneficial in prostate cancer treatment.
25852271 Report expression of IGF1R transcripts in HCV infected patients.
25824321 it was concluded that TGF-beta1, IGF-I/IGF-IR and VEGF-A overexpression is associated with the presence of aggressive tumors, which exhibit an increased probability of metastasis, a poor response to treatment and reduced survival rate.
25786252 IGF1R may play an important role in CLL biology, in particular in aggressive CLL clones characterized by IGHV-UM, trisomy 12 and NOTCH1 mutation
25780292 Suggest that miR-133a is downregulated in gastric cancer and functions as a tumor suppressor in vitro and in vivo partly by repressing IGF1R.
25758790 The insulin receptor and IGF1 receptor kinase domains are functional dimers in the activated state.
25739014 The present study revealed the pleiotropic impact of the single clustered hepatic metastamiRs miR-96-5p and miR-182-5p on IGF-1R, and an inducing effect on IGF-II and IGFBP-3 in hepatocellular carcinoma.
25693948 show that adipogenic differentiation requires primary cilia elongation associated with the recruitment of IGF-1Rbeta onto the cilium
25693802 IGF1R-mediated tyrosine phosphorylation pathway may play important roles in the regulation of sperm capacitation in humans.
25680198 Upregulation of IGF-1R expression after neoadjuvant treatment is a poor prognostic factor in breast cancer patients, providing a rationale for incorporating anti-IGF-1R drugs in the management of these patients.
25619494 Differences in IGF-axis protein expression and survival among multiethnic breast cancer patients
25617986 IGF-1R expression was a negative predictive factor for a response to EGFR-TKIs in NSCLC patients harboring activating EGFR mutations.
25613038 Our findings have important potential implications demonstrating that together with clinical prognostic factors such as radiotherapy and age, CXCR4 and IGF-1R negatively influences survival in patients with localized SS.
25609710 The data demonstrate that miR-145 influences embryo attachment by reducing the level of IGF1R in endometrium.
25604425 It is reported here that both splice variants of insulin/IGF1 receptor hybrids are activated by IGF1 with >20-fold higher potency than insulin.
25593300 Results show gene amplification of IGF1R and EGFR exclusively in malignant cases of phyllodes tumors suggesting a potential use as therapeutic targets.
25564572 The concurrent expression of OCT4/NANOG/IGFIR was mostly confined to hepatitis B virus (HBV)-related HCC (HBV-HCC) and was significantly correlated with early tumor recurrence.
25556445 IGF1R is a direct target of mir-323-5p and its targeting results in increased apoptosis and decreased cell proliferation and migration in a glioma cell line.
25520502 These experiments revealed that the C-terminal activating region 2 domain of Epstein-Barr virus LMP1 increased the mRNA expression and the secretion of the ligand IGF1, which promoted phosphorylation of IGF1R.
25492481 Our findings suggested that hsa-miR-143 could modulate cisplatin resistance of human gastric cancer cell line at least in part by targeting IGF1R and BCL2.
25483727 Basal IGF1R expression affects intrinsic resistance of cancer cells to ZSTK474.
25474488 The miR-143/145 cluster acts as a tumor suppressor in colorectal cancer through the inhibition of IGF1R translation.
25473182 IGF-1R expression level may serve as a predictive biomarker for radiosensitivity of rectal cancer before preoperative radiotherapy.
25446090 IGF1R may have a role in hypoxia-induced cancer progression and metastasis mediated by epithelial-mesenchymal transition
25425114 (99m)Tc-ZIGF1R:4551-GGGC can visualize the IGF-1R expression in human tumor xenografts and provides low retention of radioactivity in kidneys
25400749 Suggest IGF1R positive expression as an unfavorable factor for disease-free survival in NSCLC patients. IGF1R expression was associated with smoking status and tumor size.
25394492 miR-7 inhibits cellular growth and glucose metabolism in gliomas, at least partially, by regulating the IGF-1R/Akt signaling pathway.
25391374 Cotargeting IGF-1R and HER2 resulted in significant growth inhibition in breast cancer cells.
25388513 Data indicate that insulin-like growth factor 1 receptor (IGF-1 influences repair of endogenous DNA damage.
25381040 T-cadherin regulates prostate cancer cell behavior by tuning the balance in EGFR/IGF-1R activity and enhancing the impact of IGF-1R
25362932 Association between insulin-like growth factor-1 receptor (IGF1R) negativity and poor prognosis in a cohort of women with primary breast cancer.
25348345 In a population of Chinese patients with gastric cancer, IGF1R was found to be highly expressed and associated with poor prognosis.
25344917 TM4SF4 expression was correlated with the increased expression of IGF1, consequently resulting in IGF1R activation in lung adenocarcinoma.
25341922 Data demonstrate that insulin treatment induces EGFR activation by stimulating the interaction of EGFR with insulin-like growth factor receptor 1 (IGF-1R)
25339573 Silencing insulin-like growth factor-1 receptor expression inhibits gastric cancer cell proliferation and invasion.
25322858 P-cadherin is able to potentiate ligand-dependent signaling of insulin-like growth factor 1 receptor in malignant keratinocytes and epidermal growth factor receptor in dysplastic cells.
25305490 Our data indicated that let-7i might control T cells fates in AS by targeting IGF1R.
25274331 The expression of let-7b-5p was remarkably reduced in multiple myeloma tissues and cell lines, and the mRNA and protein levels of IGF1R in the RPMI-8226 cell line were down-regulated by let-7b-5p.
25268741 Picropodophyllin causes tumor cell mitotic arrest and catastrophe by depolymerizing microtubules via IGF-1 receptor-independent mechanism.
25241146 Additive impact of HER2-/PTK6-RNAi on interactions with HER3 or IGF-1R leads to reduced breast cancer progression
25211187 A soluble IGF-1R extracellular domain fragment (sol IGF-1R) interacts with GHR in response to GH.
25189651 Results indicate that IGF-1R +3179G>A polymorphism plays an important role in progression of colorectal cancer.
25187374 Follow-up replication analyses in up to an additional 21,345 participants identified three new fasting plasma glucose loci reaching genome-wide significance in or near PDK1-RAPGEF4, KANK1, and IGF1R.
25184138 miR-375 and IGF1R may serve as a novel therapeutic target for laryngeal squamous cell carcinoma.
25175038 Expression of IGF-1R is higher in esophageal squamous cell carcinoma than in adjacent normal tissue. In a xenograft model, results suggest the oncogenic function of IGF-1R in regulating cell proliferation, clonogenesis, the cell cycle and apoptosis.
25153223 Growth retardation in our patients is likely caused by the IGF1R mutation that might predispose to disturbances of carbohydrate homeostasis.
25119174 Expression of IGF-1R in gastric cancer is associated with lymph node metastasis, is correlated with worse prognosis and high histological malignancy grade, and is an independent predictor of survival in patients with gastric cancer.
25118293 High IGF1R gene copy number and protein overexpression are frequent in non-small cell lung carcinoma but they are not prognostically relevant.
25117070 High IGF1R expression was associated with glioma.
25115504 the quantitative balance between insulin-like growth factor (IGF)-1 ligand, receptor, and binding protein levels in ovarian cancer cells
25110710 IGF1R polymorphisms and abnormal microRNA expression did not correlate with IGF1R upregulation in adrenocortical tumors.
25096247 Results demonstrate that miR-194 affected the growth and metastasis of osteosarcoma cells both in vitro and in vivo suggesting that miR-194 functions as tumor suppressor gene probably by downregulating CDH2 and IGF1R.
25092925 The data identifies IRAIN as a new imprinted long noncoding RNA originating from the IGF1R promoter.
25090459 The presented data subclassified colorectal cancers (CRCs) based on their activated signaling pathways and identify a role for c-MET and IGF1R-driven PI3K signaling in CRCs, which is superior to KRAS mutational tests alone.
25081930 Low IGF-1R expression is associated with squamous cell tumours in non-small-cell lung cancer.
25081697 There was also no correlation with IGF1R expression and survival in non-small cell lung cancer.
25053419 Data indicate that glycogen synthase kinase 3 beta (GSK3beta) and transcription factors FOXO1/3/4 promote hepatoma cell proliferation through type I insulin-like growth factor receptor (IGF-IR).
25050889 The higher protein content and response to IGF-I of IGF-IR, IRS-1, and AKT observed in small for gestational age placentas may represent a compensatory mechanism in response to fetal growth restriction.
25040157 analysis of IGF1R mutations in microcephalic patients with prenatal and postnatal growth impairment
25017244 Our work provides evidence supporting a link between IGFIR and IR isoform expression levels and colorectal adenoma risk.
24999547 strong and differential expression of IGF-1R in different histological degrees of cutaneous squamous cell carcinoma indicates a possible role for IGF-insulin receptor in the carcinogenesis and differentiation of this disease
24999188 miR-145 may inhibit bladder cancer initiation by affecting IGF-IR signaling
24997432 Suggest that combined IGF1R inhibitor and methyl jasmonate administration may constitute an attractive modality for treating endometrial cancer.
24973425 MET, HER3, IGF1R, and INSR pathways activation represent novel mechanism underlying lapatinib unresponsiveness in HER2+ gastric cancer. Combination strategy may be recommended in treating patients with HER2+ gastric cancer with these pathways activation
24970814 Data indicate that engineered ubiquitin ligase is an effective therapeutic strategy for the treatment of the cancers with co-expressed insulin receptor/insulin-like growth factor receptor (IR/IGF-1R).
24956249 there is no evidence that IGF2 methylation was influenced by SNPs within the IGF1, IGF1R or IGF2R genes, which lie on other chromosomes.
24939178 IL6 stimulated SOD2 expression that, at least partially, contributed to the low level of ROS that would likely result in a sustained increase in the expression of IGF-1R through abolishment of beta-arrestin1 in docetaxel resistant cells.
24922664 High IGF1R mRNA expression is associated with advanced non-small cell lung cancer.
24909165 Taken together, topographic and functional interactions between dynactin, importin-beta and RanBP2 are involved in nuclear translocation of IGF-1R.
24874051 Data indicate that insulin-like growth factor 1 receptor (IGF1R) was a target of miR-195 in non-small cell lung cancer (NSCLC)cells.
24870578 Changes in IGF-1 and IGF-1R on monocytes and granulocytes seem to be part of the mechanism that facilitates recovery from resistance exercise during earlier stages of muscle recovery.
24811788 results support growth-promoting role of IGF system in placental/fetal development and suggest that IGF1R and IGFBP3 DNA methylation profiles are dysregulated in maternal impaired glucose tolerance, potentially affecting the fetal metabolic programming
24810113 Increased expression of IGF1R is associated with oral squamous cell carcinoma.
24809702 the significance of IGF-1R in pancreatic cancer
24809298 Overexpression of IGF1R increased cell proliferation, colony formation, migration, invasion and resistance to apoptosis in prostate cancer.
24801045 suggest that first pregnancy characteristics may exert an influence on extent of breast density later in life and that this influence may vary depending on inherited IGFR1 and vegf genotype
24770843 proliferation of young and aged human dermal fibroblasts in 3D collagen and its association with baseline levels of IGF1R expression were measured
24758241 genetic polymorphism is associated with hepatitis B virus-related hepatocellular carcinoma
24751329 MRNA levels of IGF-1 and IGF-1R were significantly higher in colorectal cancer tissue compared with its non tumor tissue in patients with and without type 2 diabetes.
24745653 The results may suggest that the IGF-IR AA polymorphism is beneficial for endurance-type sports, but is not associated with elite endurance performance. In contrast, the presence of the AA genotype may be a disadvantage in power sports.
24745618 single nucleotide polymorphisms and mutations in the insulin-like growth factor 1 receptor can be detected and may harbor prognostic value in non-small cell lung cancers
24745611 Loss of Klotho protein expression, klotho promoter hypermethylation, high miR-504 levels, and high phospho-IGF-1R levels significantly correlated with poor survival, high clinical and pathological stages in pancreatic ductal adenocarcinoma patients
24713135 IGF1R overexpression was a significant predictor of overall survival in patients with transitional cell bladder cancer.
24683100 Different insulin receptor family expression levels were measured in six cancer cell lines.
24667580 Plasma IGF-1R displayed a potential value for distinguishing pancreatic lesions and could be a new biomarker for guiding TNM stage of pancreatic cancer.
24655723 our findings suggest miR-630 as a key regulator of cancer cell progression in HER2 over-expressing breast cancer, through targeting of IGF1R.
24637962 Aberrant expression of components of the IGF1R pathway is associated with better clinical outcomes in women with luminal A and B, node positive, early breast cancer.
24599933 Data indicate that the inhibitor of DNA binding 1 (Id1)-IGF-II-IGF-IR-AKT signaling cascade plays an important role in esophageal cancer progression.
24571711 Epigenetic silencing of miR-375 induces trastuzumab resistance in HER2-positive breast cancer by targeting IGF1R.
24489919 IGF-1R expression is correlated with positive outcome in patients with classical Hodgkin lymphoma.
24489728 Hypoxia increased the population of lung cancer stem cells resistant to gefitinib in EGFR mutation-positive non-small cell lung cancer by activating IGF1R.
24458568 IGF1R activation is a molecular mechanism that confers acquired resistance to erlotinib in lung cancers with the wild-type EGFR
24438088 Targeting the IGF-1R/Akt pathway with glucosamine may be an effective therapeutic strategy for treating some type of cancer.
24410957 miR-99a functions as a tumor metastasis suppressor in Oral squamous cell carcinoma cells and mutually regulates IGF1R
24392142 this case-control study demonstrates statistically significant associations between breast cancer risk and polymorphisms in IGF1R gene.
24379526 In epiretinal membranes (ERMs), IGF1 and IGF1R mRNA levels were significantly higher in patients with diabetes compared to control subjects.
24378652 miR-503 is a tumor suppressor for glioblastoma and a favorable factor against glioma progression through targeting IGF-1R.
24354797 The expression pattern of IGF-1R in archival tissue samples of hepatic metastasis from 24 patients was analyzed by immunohistochemistry.
24351920 investigate the expression of IGF-1, IGFBP-3 and IGF-1R in STRO-1-positive dental pulp stem cells (DPSCs) and fully impacted wisdom teeth in relation to tooth development
24336871 a key player in mediating Tissue Factor/ Factor VIIa-induced cell survival
24324762 decoy nucleotides which were complementary to the 5', central or 3' region of mature miR-223 suppressed miR-223 targeting the 3'UTR of IGF1R.
24307738 that platelet-released miR-223 promotes advanced glycation end product-induced vascular endothelial cell apoptosis via targeting insulin-like growth factor 1 receptor.
24285539 LKB1 expression in cancer cell resulted in dephosphorylation of several tumor-enhancing RTKs, including ErbB2, hepatocyte growth factor receptor (c-Met), EphA2, rearranged during transfection (RET), and insulin-like growth factor I receptor.
24282274 Data indicate that the blockade of IGF-I receptor (IGF-IR) and ErbB3 receptor (ErbB3) survival pathways and downstream resistance mechanisms was achieved with MM-141.
24266654 Integrated p38 MAPK and IGF-1R signals inversely control STAT3 activity to maintain human dental pulp stem cells quiescence and activation.
24250812 Inhibition of miR-223 was found to maintain the undifferentiated state of hESCs, while addition of miR-223 induced differentiation. Furthermore, these effects were found to be likely dependent on IGF-1R/Akt signaling
24227890 HER2 and IGF-IR may be clinically beneficial in minimizing the acquired resistance to trastuzumab therapy.
24222252 The rs1976667 and rs2684788 loci of the human IGF-1R gene are likely associated with different genetic susceptibilities to idiopathic short stature.
24219294 Activation of IGF-1R can induce apoptosis in adipose-derived stem cells, whereas it can be prevented by the A20 and osteocalcin expression.
24206174 Immunohistochemical staining for EGFR, HER2 and IGF-1R was undertaken in 31 ovarian adult granulosa cell tumors. Tumor DNA was also analysed for mutations in the tyrosine kinase domain of EGFR (exons 18-21).
24186206 Data indicate that IGF-1R influences double-strand break (DSB) repair by both major DSB repair pathways.
24135282 a major activity of DNp73 is to establish initiation of the invasion-metastasis cascade via EPLIN-dependent IGF1R regulation
24130778 IGF-IR stabilizes the beta1 subunit by protecting it from proteasomal degradation
24127040 Rescue experiments showed that ectopic expression of IGF1R significantly promoted the proliferation of ovarian cancer cells stably overexpressing miR-133a
24065146 Experiments confirmed that combined inhibition of CDK4 and IGF1R cooperatively suppresses the activation of proteins within the AKT pathway
24055032 Simultaneously blocking EGFR, IGF1R and Bcl-xl genes is capable of altering the balance between proliferating versus apoptotic and senescent cells in the favor of both of apoptosis and senescence and, therefore, the tumor cells regression.
24039995 Data indicate that miR-140 downregulates insulin-like growth factor 1 receptor (IGF1R) by directly targeting its 3' untranslated regions (3' UTR).
24039934 Type I IGFR is autophosphorylated in brain-seeking breast cancer cells.
24026884 The IGF axis might play a key role in tumor progression of esophageal carcinomas. The IGF-IR targeting strategies might thus be useful anticancer therapeutics for human esophageal malignancies.
24013232 FBLN3 suppresses both epithelial-to-mesenchymal transition and self-renewal of lung cancer stem cells by modulating the IGF1R pathway.
23994953 The sole presence of erlotinib was capable of rapidly activate an IGF-1R-dependent, vimentin-enriched mesenchymal-like phenotype in delE746-A750-mutated epithelial cells.
23990442 there was no obvious correlation between IGF-1R expression and patient survival.
23989734 Results indicated that systemic lupus erythematosus activity is affected by a modulation of the insulin-like growth factor-1 signal pathway and +3179G/A IGF-1R polymorphism.
23983239 Low PTEN protein expression significantly increases the risk of lethal prostate cancer, particularly when the IGF-IR expression remains at normal level.
23980150 miR-486 directly targets components of insulin growth factor (IGF) signaling including IGF1, IGF1 receptor, and phosphoinositide-3-kinase, regulatory subunit 1alpha (PIK3R1, or p85a) and functions as a potent tumor suppressor of lung cancer.
23974362 demonstrated that let-7a1-mediated IGF1R downregulation was accompanied by attenuation of Elk1 activity and c-fos expression, inhibition of cell proliferation, enhanced apoptosis and cell cycle arrest
23962053 IGF1R signaling might be associated with tumor aggressiveness, and IGFBP3 might show antiproliferative effects in pancreatic cancer.
23928059 PDGFRalpha and IGF-1R are dynamically regulated and distributed in nucleus and cytoplasm in alveolar Rhabdomyosarcoma.
23899556 Phosphorylation of P-Rex1 at serine 1169 participates in IGF-1R signaling in breast cancer cells.
23879873 rs4966014 was associated with left ventricular hypertrophy in type 2 diabetic patients.
23873272 there is a rethinking as to where and how IGFR-1 inhibition can be effectively harnessed as an antineoplastic tool
23867124 Report co-expression of IGF-1R and ALK in embryonal and alveolar rhabdomyosarcoma and suggest both as possible drug targets.
23864387 The consequent increase in IGF-IR mRNA stability.
23861540 Network models inferred from the data revealed a conserved set of signaling pathways and RTK-specific features that grouped the RTKs into three distinct classes: (i) an EGFR/FGFR1/c-Met class ; (ii) an IGF-1R/NTRK2 class; and (iii) a PDGFRbeta class.
23861377 Data from knockout/transgenic mice suggest that neither IGF1R (human or mouse) nor Ghr (growth hormone receptor) signaling is required for postnatal skeletal muscle development or for regeneration in response to cardiotoxin injury.
23857432 inhibition of IGF-IR and targeting of the JAK2/STAT3 signaling pathway can be a target for ovarian cancer therapy.
23831640 These results suggest an important role for TGF-beta1 in osteosarcoma cell growth, with the induction of IGFBP-3 by TGF-beta1 serving in a negative-feedback loop to control cell growth by preventing activation of the IGF1R.
23823800 ganitumab therapy modestly affected 22Rv1 tumor growth, combining IGF-1R blockade with calorie restriction resulted in a significant decrease in final tumor weight and improved metabolic profile.
23821363 These results clarify the relationship between ER-alpha and PDZK1, propose a direct relationship between PDZK1 and IGF1R, and identify a novel oncogenic activity for PDZK1 in breast cancer.
23818948 Data indicate that combination therapy of IGF receptor (IGFR) inhibitors with other molecular targeted agents (MTA) may improve the therapeutic efficacy in hepatocellular carcinoma (HCC).
23817810 High membranous/cytoplasmic pIGF1R expression is associated with brain metastases.
23814047 an important role for PTP1B as a negative regulator of BRK and IGF-1Rbeta signaling in ovarian cancer cells.
23801064 High circulating IGF1 concentrations and mucosal IGF1R expression may play important roles in both the formation and development of colorectal carcinoma.
23797814 Data suggest that the down-regulation of insulin-like growth factor I receptor (IGF-IR) expression could be a specific molecular target for hepatoma cell proliferation.
23792093 results suggest that IGF-1R and HER3 differentially regulate trastuzumab resistance and could be promising targets for trastuzumab therapy in ovarian cancer
23782942 Data suggest growth hormone (GH) potentiates estradiol effects on proliferation in breast cancer cells expressing high levels of GHR; GH/GHR signaling overcomes antiproliferative effect of insulin-like growth factor I receptor tyrosine kinase inhibition.
23744486 Data suggest that detection of ductal carcinoma in situ (DCIS) based on marker expression during breast conserving surgery should be possible with a panel of molecular imaging tracers targeting CD44v6, GLUT1, HER2, IGF1-R, and EGFR.
23730215 dual mutation of Tyr644 and Tyr664 in NPM-ALK abrogates its physical association with IGF-IR.
23724116 The glycosylation of IGF-1R is necessary for the full activation of the receptor in response to androgen treatment and that perturbing this process can break the feedback loop between AR and IGF-1R activation in prostate cells.
23710710 The existence of an autocrine loop in the IGF-1R/Akt pathway.
23704881 Estradiol and IGF-I induced the rapid association of ER to IGF-IR.
23696648 1) IGF1 induces signals under anchorage-independent conditions and that 2) R36E/R37E acts as a dominant-negative inhibitor of IGF1R (IGF1 decoy). Our results are consistent with a model in which ternary complex formation is critical for IGF signaling.
23689439 IGF1 and IGF1R expression is associated with favorable clinicopathologic parameters and may involve early carcinogenesis of small intestinal neoplasms.
23675407 Upregulation of miR-150* and miR-630 induces apoptosis in pancreatic cancer cells by targeting IGF-1R.
23664098 (111)In-F(ab')-R1507 fragments can successfully target IGF-1R in Ewing sarcoma.
23663564 Our data support the notion that IGF-1R is a marker of stemness, and IGF-1R and its downstream PI3K/Akt/mTOR pathway are attractive targets for therapy directed against breast cancer stem/progenitors.
23619944 data indicate that knocking down insulin-like growth factor-1 receptor (IGF-1R) expression through shRNA can render gefitinib-resistant cell lines sensitive.
23564324 We report that miR-383 was downregulated in gliomas and inversely correlated with glioma pathological grades; we demonstrated that IGF1R expression is critical for miR-383 downregulation-induced cell invasion.
23549953 Igf-1r SNP was found to be significantly associated with age at diagnosis of breast cancer in Jewish Ashkenazi BRCA1 mutation carriers.
23548939 In theca cells and granulosa cells, insulin-like growth factor receptor-1 signaling is decreased in response to IGF-1 induced steroid production.
23539445 show that IGF-IR-mediated POU5F1 expression to form a complex with beta-catenin and SOX2 is crucial for the self-renewal and oncogenic potentials of lung adenocarcinoma stem-like cells
23531874 Data indicate that IGF-1R and SGLT1 interact in HEK293 and MCF7 cells, and IGF-1R siRNA transfection results in down-regulation of SGLT1.
23527719 IGF1R is differentially-expressed in different types of human sarcomas, and targeted blockade of IGF1R pathway may inhibit human OS migration through down-regulation of MMP-2/-9 expression
23526299 IGF-1-induced delayed MET activation occurs in cell lines which express both receptors, suggesting that IGF-1R-mediated MET activation may contribute to tumorigenic properties of multiple cancer types when both growth factor receptors are expressed.
23515613 Taken together our data support IGF-1R inhibition as a viable treatment strategy for a defined subset of SCLC
23507142 the role of miR-16 as a tumor suppressor by targeting IGF1R in OS
23506534 Results strongly suggest that IGF-1R is associated with malignancy in familial pheo/pgl and that IGF-1R expression in the primary tumour might be a useful tool to detect those patients harbouring pheo/pgl who have an increased risk of metastasis
23486542 Small, intragenic deletions of IGF1R in two unrelated families affected primarily with neuropsychiatric phenotypes including developmental delay, intellectual disability and aggressive/autoaggressive behaviors, are reported.
23460259 Our results indicate that GRK2 has contrasting roles on HepG2 cell growth by negatively regulating the IGF-1R signaling pathway and cyclins' expression.
23453369 Small interfering RNA-mediated IGF-1R knockdown could mimic the effect of enforced miR-497 expression on the malignant phenotypes of cervical cancer cells
23431408 MiR-181b overexpression inhibited cell proliferation, migration, invasion, and tumorigenesis by targeting IGF-1R and its downstream signaling pathways.
23418605 Data indicate statistically significant correlations were observed between the number of circulating epithelial tumor cell (CETC) and IGF-IR and VEGFR-2 expression.
23416929 NF-kappaB bound the putative IGF1R promoter at position -230 to -219 bp.
23404184 Although the exact roles of Cav-1 and IGF-IR in human cancer continue to be a matter of some debate, there is a strong evidence for an association between Cav-1 and IGF-IR in cancer development.[review]
23402816 Neutralization of IGF1R signaling enhances the cytotoxic effects of antineoplastic agents in endometrial cancer.
23395167 the LRP6(R611C) mutation diminishes TCF7L2-dependent transcription of the IR while it increases the stability of IGFR and enhances mTORC1 activity.
23374155 The constitutive gene expressions of estrogen receptor beta and SDC-4 are mediated mainly through the EGFR signaling axis, whereas SDC-2 expression is regulated by both EGFR and IGFR pathways.
23373509 The regulation of IGF1 receptor expression by microRNA-100 in metatstatic and nonmetastatic pancreatic tumor cell lines is reported.
23365645 IGF1R-alpha protein overexpression may serve as an independent predictor of relapse and survival in operable laryngeal cancer.
23360921 With locally advanced pancreatic cancer, SNP rs1124736 (IGF1R) was associated with improved survival if they had a copy of the G allele.
23354097 WT-IGFBP-1 inhibited IGF-IRbeta autophosphorylation (~2-fold, P < .001), possibly attributable to sequestration of IGF-I.
23331867 IGF1R coupled with Sdc1 is required for activation of the alphaVbeta3 integrin and for VEGFR2 signalling.
23314677 Patients with concomitant IGF1R/EGFR fluorescence in situ hybridization immunohistochemistry had a worse disease-free survival and overall survival
23288662 IGF-1R mRNA expression was also significantly higher in Follicular adenoma, nodular goiters, and Papillary thyroid carcinoma compared with the controls.
23266446 IGF-1R is highly expressed in lung squamous cell carcinoma and mucinous adenocarcinoma, although copy number alterations in the IGF-1R gene were rare.
23252569 IGF1R overexpression in KIT/PDGFRA WT GIST could be driven by the loss-of-function of the SDH mitochondrial complex.
23250396 a model whereby IGFBP7 binds to unoccupied IGF1R and suppresses downstream signaling, thereby inhibiting protein synthesis, cell growth, and survival.
23239200 conclude that inhibition of IGF-1 receptor tyrosine kinase activity by PQIP suppresses breast cancer-induced bone turnover and osteolysis
23190452 Studies indicate that insulin receptor (IR) and IGF Type 1 Receptor (IGFR) have been identified as important partners of Grb10/14 and SH2B1/B2 adaptors.
23152410 Cathepsin X deficiency leads to a reduced phosphorylation of the IGF-I receptor in response to IGF-I stimulation.
23118311 Insulin-like growth factor 1 triggers a fast and independent nuclear calcium (Ca2+) signal in neonatal rat cardiac myocytes, human embryonic cardiac myocytes, and adult rat cardiac myocytes.
23109135 Data indicate that SDHB-deficiency was tightly associated with overexpression of IGF1R protein and transcript, and Biallelic inactivation of the SDHA gene was identified in 5 of 11 SDHB-negative gastrointestinal stromal tumors.
23106397 IGF1R activation partially reverses cell cycle arrest caused by gefitinib in OSCC cells. IGF1R stimulation does not eliminate the gefitinib-induced increase in total p27, phosphorylation state and subcellular localization are altered.
23082760 horizontal transfer of the mRNA for IGF-1R to tubular cells through exosomes potentiates tubular cell sensitivity to locally produced IGF-1 providing a new mechanism underlying the powerful renoprotection of few Bone marrow-mesenchymal stem cells.
23056576 Results demonstrate that miR-122 functions as a tumor suppressor and plays an important role in inhibiting the tumorigenesis through targeting IGF1.
22998174 The identification of an inactivating IGF1R mutation in the present cohort should encourage further studies of larger series to establish the precise frequency of this molecular defect in children with growth impairment of a prenatal onset.
22972910 Rare IGF1R variants exerting a moderate effect on stature are present in the general population.
22935141 miR-148a and miR-152 act as tumor suppressors by targeting IGF-IR and IRS1, and that restoration of miR-148a/152 expression may provide a strategy for therapeutic application to treat BC patients.
22932330 IGF-1R plays a role in the development of uveal melanoma, which may be induced by activation of the PI3K/AKT pathway.
22931894 MVP and IGF-1R expression are related in oral squamous cell carcinoma and conferred reduced long-term survival in patients suffering from advanced stages of the disease
22909219 IGF1R may be a risk factor of susceptibility in PTC.
22894899 Disruption of the protein interaction between FAK and IGF-1R inhibits melanoma tumor growth.
22892600 The consistent lack of IGF1R expression in intestinal gastrointestinal stromal tumors should be considered an additional immunohistochemical marker in the differential diagnosis between them and non-gastrointestinal stromal tumor sarcomas.
22879999 The nuclear localization and function of the IGF-1R/INSR (Hybrid-R) and the role of IGF-1/IGF-1R and Hybrid-R signaling in the human corneal epithelium.
22875931 study demonistrated that the first time that zinc can induce IGF-1Rbeta protein degradation in neurons via NEDD4-mediated ubiquitination and the subsequent UPS mechanism.
22825921 Human cardiac microvascular endothelial cells express more IGF1Rs than IRs, and mainly react to IGF1 due to the predominance of IGF1Rs and insulin/IGF1 hybrid receptors.
22777769 IGF-IR expression positively correlates with PTEN and inversely correlates with NRP2 in prostate tumors
22767591 PI3K activity bound to IGF-IR, which is continuously sustained by IGF-I stimulation, is required for IGF-I-induced cell proliferation.
22738321 A novel heterozygous IGF1R missense mutation in exon 7 was identified in a short-statured girl with severe prenatal growth retardation and microcephaly; the same mutation was identified in her mother and grandmother.
22710713 these results identify downregulation of miR-497 as an important mechanism of upregulation of IGF1-R in colorectal cancer cells that contributes to malignancy of colorectal cancer.
22700994 strong protein expression of IGF-1R and EGFR was observed in thymic carcinoma and in both thymoma and thymic carcinoma, respectively. However,IGF-1R or EGFR gene amplification was rare in thymic epithelial tumors irrespective of protein expression.
22685298 SFYYS motif controls the organization of the IGF-1R C terminus relative to the kinase domain. Its phosphorylation by GSK-3beta restrains kinase activity and regulates receptor trafficking and signaling.
22682017 Nuclear localisation of IGF-1R is an easily testable biomarker associated with a better progression-free survival and overall survival for patients treated with IGF-1R Ab therapy.
22635104 IGF-1 receptor activation triggers an increase in p75 neurotrophin receptor protein expression in hippocampus.
22626974 Data suggest that IGF-1R shRNA delivery can be valuable for RNA interference therapy to tumors in vivo.
22623732 Patients who had high baseline IGF-1 levels had significantly higher disease control rate (DCR) than patients who had low baseline IGF-1 levels .
22614005 MicroRNA-7 functions as an anti-metastatic microRNA in gastric cancer by targeting insulin-like growth factor-1 receptor.
22572840 genetic association studies in a population of German children: Data suggest that mutations in IGF1R and/or SHOX (but not IGF1) are associated with short stature in a small percentage of short children.
22555179 Succinate dehydrogenase-deficient gastro-intestinal stromal tumors are characterized by IGF1R overexpression.
22541124 Insulin promotes the proliferation of Reh cells. High expression levels of IR and IGF-IR may be closely related with the growth of leukemia cells.
22509025 GRK2 and GRK6 coimmunoprecipitate with IGF-1R and increase IGF-1R serine phosphorylation, promoting beta-arrestin 1 association.
22508822 Ganitumab, a fully human anti-type-1 insulin-like growth factor receptor antibody, was well tolerated and demonstrated antitumor activity in patients with advanced recurrent Ewing family tumors or desmoplastic small round cell tumors.
22506015 This requires active ADAM17, a membrane associated metalloproteinase, and the phosphorylation of IGF-1R.
22495974 Epigenetic regulation of PITX2 during the course of the disease may lead to orchestrated control of the AR and IGF signaling pathways.
22438913 an absence of N-linked glycosylation at N913 led to a lack of membranous localization of IGF1R and figitumumab insensitivity
22424712 miR-223 contributes to IGF1R regulation, but may act in concert with other genes and/or microRNAs to alter T-cell acute lymphoblastic leukemia biology.
22419550 Inactivation of TROP2 due to loss of heterozygosity or by DNA methylation may play an important role in lung cancer tumourigenicity through losing its suppressive effect on IGF-1R signalling and tumour growth.
22406993 we confirmed that novel shorter soluble IGF-IR 223/STOP and 325/STOP possessed almost the same antitumor effects as reported for 486/STOP.
22394253 probe enables us first to lock the GABA(B) receptor in an inactive state and then activate it with a positive allosteric modulator, thereby permitting monitoring of the dynamic of the protein complex associated with IGF-1R transactivation
22372631 Patients whose chordomas show a moderate to strong staining intensity in >/= 50% of tumour cells for IGF-1R (36%) might benefit most from IGF-1R targeting.
22348393 discuss some of the recent results on the functional role and potential clinical use of the IGF-1R, one of the major mediators of growth and survival for multiple myeloma
22343486 c-Met, epidermal growth factor receptor, and insulin-like growth factor-1 receptor are important for growth in uveal melanoma and independently contribute to migration and metastatic potential
22339909 IGF-IR expression level on the clone cells from the myelodysplastic syndrome cases was markedly elevated compared to the corresponding level on normal cells.
22336232 IGF-1R+1013(G/A) polymorphism alone or in combination with IGF-2R +1619(G/A) polymorphism was associated with the overall survival period in patients with advanced NSCLC after treatment with platin-based chemotherapy.
22335030 Abnormal IGF-IR and VEGF-C expression may be important in lymph node metastasis of endometrial adenocarcinoma and might be used to evaluate the prognosis.
22325222 The overexpression of IGF-1R is colerated with lymph node metastasis, differentiation and clinical stage of esophageal squamous cell carcinoma. Down-regulation of IGF-1R can inhibit the proliferation of esophageal cancer EC9706 cells in vitro.
22309212 The results of this study suggest a novel link between a mutation at the IGF-IR L2 domain and intrauterine and postnatal growth retardation.
22303694 Overexpression of IGF-1R might play an important role in the formation of nasal polyps. IgE-mediated hypersensitivity has no contribution to the overexpression of IGF-1R.
22285568 High IGF-1R expression was associated with squamous cell carcinoma than adenocarcinoma in non-small-cell lung cancer.
22275271 study of hypothesis that IGF-IR overexpression may be involved in MRP-2 mediated multidrug resistance in colorectal cancer cells; findings improve current understanding of the biology of IGF-IR and multidrug resistance
22261717 nuclear IGF1R associates with the transcription factor LEF1 and increases promoter activity of LEF1 downstream target genes cyclin D1 and axin2.
22246875 This study demonistrated that IGF-1 receptor beta subunit (IGF-1Rbeta) was significantly increased in skeletal muscel in patient with amyotrophic lateral sclerosis.
22235273 short interfering RNA (siRNAs) for inhibition of in vivo tumor growth and immunological stimulation in immunocompetent mice
22218435 As many patients present with few altered clinical and laboratory data, IGF1R defects must be suspected in cases of small for gestational age without postnatal growth recuperation.
22194466 our findings define an IGF-IR-mediated mechanism of cancer cell survival that is critical for metastatic colonization of the liver.
22188815 Data suggest that tumor-derived IGF-2 in the microenvironment maintains angiogenesis in the presence of IGF-1R-targeted antibodies allowing tumor progression.
22179513 NKX3.1 inhibits IGF-1R expression and its signalling pathway in human prostatic carcinoma PC3 cells.
22172258 The allele A at rs1976667 SNP of IGF-IR gene is a risk factor for idiopathic short stature (ISS).
22161861 Data support the concept for dual IGF-1R/IR targeting in hepatocellular carcinoma (HCC).
22146489 examined the differential role of the IGF system in esophageal adenocarcinoma and squamous-cell carcinoma and its association with visceral obesity; results indicate IGF-1 axis has a key role in progression of esophageal cancer and represents a plausible mechanism through which visceral obesity impacts on esophageal adenocarcinoma risk and tumor biology
22140443 This study has therefore lead to a greater understanding of the mechanisms of IGF-II binding and activation of the IGF-1R and IR-A.
22133293 High IGF1R is associated with postoperative recurrence in patients with adenocarcinoma in non-small-cell lung cancer.
22130793 The p.E121K/E234K variant is the cause of intrauterine growth retardation and the most severe postnatal growth failure described to date in a patient with IGF1R defects.
22128190 IGF-IR stimulated IGF-IR gene expression, IR inhibited IGF-IR promoter activity.
22120672 Data show that inhibitors of Stat3, IGF-IR and Rho GTPase were the most promising therapeutic agents for ovarian cancer.
22115966 Results suggest that EGR-1 may stimulate prostate cancer cell growth through up-regulation of IGF-1R and indicate that down-regulation of EGR-1 could be an effective therapeutic approach against prostate cancer.
22115178 For the IGF-1R rs2229765 polymorphism, as male carriers of the homozygous A/A genotype survived longer, while the IL-6 rs1800795 genotype did not influence overall or sex-specific longevity.
22058336 These data suggest a role of IGF1R on the risk for advanced age-related macular degeneration in this group of subjects.
22044563 IGF-IR might identify a subset of biliary tract carcinomas with a particularly aggressive phenotype and is a candidate therapeutic target in this disease.
22042973 Data show that that the IGF1R pathway is a potential therapeutic target for patients with malignant peripheral nerve sheath tumor (MPNST).
22033326 p53 regulates IGF-IR gene expression in uterine serous carcinoma cells via a mechanism that involves repression of the IGF-IR promoter
22020329 the mammary tumors that develop in MTB-IGFIR transgenic mice
22020193 activating mutation of PIK3CA, loss of PTEN, or IGF1R expression have a role in round cell transformation
21994939 Polyubiquitination of insulin-like growth factor I receptor (IGF-IR) activation loop promotes antibody-induced receptor internalization and down-regulation.
21972777 effect of mutations in IGF1 and IGF-1R genes are explained in terms of effect on ligand binding and receptor activation; severity of patient phenotype can generally be correlated to the effect of the mutation on protein structure and function [review]
21959795 The gefitinib treated cells displayed increased levels of phosphorylation in IGF-1R.
21958043 Zyflamend inhibited Insulin-Like Growth Factor I stimulated cell growth, IGF Type 1 Receptor, and androgen receptor expression and its nuclear localization in CWR22Rv1 cells.
21943825 Data show that Rac1 was highly activated in PTEN deficient and IGF-IR overexpressing Trastuzumab-resistant cells in a HER2-independent manner.
21939528 erbB3 recruitment of insulin receptor substrate 1 modulates insulin-like growth factor receptor signalling in oestrogen receptor-positive breast cancer cell lines
21931726 histone deacetylase inhibitor vorinostat interacts with the insulin-like growth factor signaling pathway
21908557 Knockdown of InsR and/or insulin-like growth factor-I receptor inhibited growth of 3 of 4 long-term estrogen-deprived MCF-7 cell lines.
21873172 While IGF-1R was significantly correlated to colorectal tumor size & depth of invasion in univariate analysis, only tumor size had a strong association in multivariate analysis.
21866554 IGF-1R is an independent prognostic marker for osteosarcoma patients and increased expression of this molecular is correlated with metastasis of osteosarcoma.
21862872 Metformin disrupts erbB2/IGF-1R complexes, erbB3 and IGF-1R expression and activity.
21852217 We genotyped single-nucleotide polymorphisms of IGF1, IGF2, IGF1R, IGF2R, IGFBP1, IGFBP3, IGFBP5, IRS1, IRS2, and IRS in pancreatic cancer patients
21845403 In muscle, the most notable changes were 28% lower gene expression of IGF-1Ea and 40% lower expression of IGF-1Ec in the postmenopausal non-users than in premenopausal women, and 28% higher expression of IGF1-receptor in HRT users than in non-users.
21840990 decorin loss may contribute to increased IGF-IR activity in the progression of bladder cancer
21811077 association between a novel IGF1R nonsense mutation and a variable degree of alterations in prenatal and postnatal growth and in carbohydrate metabolism.
21807868 IGF1R is a Notch1 target, and Notch1 signaling is required to maintain IGF1R expression at high levels in T-ALL cells.
21799000 After IGF-I stimulation, CTK is recruited to IGF-IR and its recruitment facilitates CTK's subsequent association with phospho-SHPS-1.
21748295 IGF1R mRNA expression appeared to be a good prognostic marker both in the entire cohort and in the luminal subtype group.
21732141 the present study demonstrated that expression of IGF1R was lower in moderately to poorly differentiated lung adenocarcinoma, and that low IGF1R expression was associated with poor prognosis in patients with lung adenocarcinoma.
21729677 IGF1R overexpression is associated with resistance to cetuximab in metastatic colorectal cancer.
21728395 IGF-1R can be considered a biomarker for the stage and risk of carcinogenesis during neoplastic initiation and progression along the colorectal normal mucosa-polyp-cancer sequence
21713359 The IGF-IR and MAPK kinase pathway involving proteins ERK1/2 showed more significant phosphorylation in the 1,595 cells compared to the observed in the MCF-7 cell line.
21687694 miR-99a is one of the regulators of the IGF-1R signaling pathway in keratinocytes
21685939 Functional experiments showed that LL-37-dependent activation of the IGF-1 receptor signaling resulted in increased migratory and invasive potential of malignant cells.
21677874 Data suggest that the relatively high expression of the IGF receptors in triple-negative breast cancer cells suggests that the IGF signal pathway may be important in controlling cell proliferation and cell survival in this subtype of breast cancer.
21677036 Autoimmunity against IGF-1R is not specific for Graves' disease but may contribute to ongoing immune reactions.
21654344 Results suggest that IGF-1-IGF-1R autocrine pathway in melanoma is a possible target for therapy in human melanomas.
21645859 Fine details of insulin-like growth factor 1 receptor activation, inhibition, and asymmetry determined by associated hydrogen /deuterium-exchange and peptide mass mapping
21620944 Propose a Systems Biology approach to understand the molecular biology of EGFR and IGF1R pathways in non-small cell lung cancer.
21611203 IGF1R internalization and co-localization with clathrin and CAV1 upon ligand binding, as well as the status of the IGF1R pathway, cellular proliferation, and the apoptosis of interfered and inhibited Ewing's sarcoma, were analyzed.
21595894 Our data provide evidence that the IGF-1/IGF-1R signaling axis may play a causal role in antiestrogen resistance of breast cancer cells, despite continuous suppression of ER transcriptional function by antiestrogens.
21574055 IGF-1R correlates with good prognostic markers among patients with early breast cancer and is differentially expressed with variable prognostic impact among breast cancer subtypes.
21546606 hCSCs expressing only IGF-1R synthesize both IGF-1 and IGF-2, which are potent modulators of stem cell replication, commitment to the myocyte lineage, and myocyte differentiation
21538027 Inhibition of PI3K reduced rhTRAIL sensitivity independently of the cell line preference for either DR4- or DR5-mediated apoptosis signaling.
21524684 insulin and IGF-I activate their cognate receptors and IGF-I also activates naturally occuring IGF-I/insulin hybrid receptors (HR) IGF-II activates insulin receptor, IGF-I receptor and HR
21471532 Data show that HLE-B3 cells express only the IGF-1Ea and IGF-1R transcripts.
21450456 Insulin-like growth factor-I receptor (IGF-IR) targeting with monoclonal antibody cixutumumab (IMC-A12) inhibits IGF-I action in endometrial cancer cells
21447712 Data indicate that the IGF receptors IGF1R showed significantly increased mRNA levels in alveolar and embryonal rhabdomyosarcoma compared to the normal skeletal muscle.
21447702 IGF1R expression and activity via osteoprotegerin can modulate vascular smooth muscle cell calcification.
21442237 Data suggest that lentivirus-mediated shRNA targeting IGF-1R has the potential to develop as a clinical treatment method in advanced and chemoresistant endometrial carcinoma.
21410323 in breast cancer cells, IGF-2 activates ER-alpha and ER-beta, and modulates their translocation to nucleus, membrane organelles and mitochondria; IGF-2 actions are mediated by the IGF-1R and the insulin receptor
21402719 Data show that the 17-mer PNA formed a PNA(2):mRNA complex with a purine-rich sequence located in the coding region of IGF-1R mRNA.
21396585 research has found evidence that IGF1R mutations are causally linked to the aetiology of small for gestational age (SGA) [review]
21393993 Data show that EI-04 as a superior cancer therapeutic in treating EGFR and IGF-1R pathway responsive tumors.
21388493 The human longevity-associated IGF type-1 receptor (IGF1R) variants are reduced-function mutations, implying that dampening of IGF1 signaling may be a longevity mechanism in humans.
21372220 Data show a novel protumorigenic mechanism in TEMs, Hsp90-capacitated overexpression of IGF-1R, which confers apoptosis evasion in malignant thymic epithelial cells.
21340542 A-IGF1R/Asp-IRS2/Val-UCP2 allele combination is associated with a decreased all-cause mortality risk and with an increased chance of longevity.
21338601 Data suggest that FAK is critically involved in osteolytic metastasis and activated in tumors, pre-osteoclasts, mature osteoclasts, and bone stromal cells, and the FAK/IGF-1R inhibitor TAE226 may be used for cancer induced bone metastasis.
21330319 IGF-IR is up-regulated and frequently activated in mantle cell lymphoma.
21317933 P-cadherin cooperates with insulin-like growth factor-1 receptor to promote metastatic signaling of gonadotropin-releasing hormone in ovarian cancer via p120 catenin.
21304894 these findings support the identification of the novel susceptibility gene IGF1R for predisposition by the fetal genome to being born preterm.
21292299 Synchronized up-regulation of the insulinlike growth factor I receptor axis in tumor cells and intratumoral and adjacent arterioles could represent a mechanism of hepatocarcinogenesis and progression.
21273178 intensity of anti-IGF-1R immunostaining for 21 patients with small-cell lung cancer was correlated to survival.
21258401 These findings indicate that IL-6 signaling cooperates with IGF-IR signaling in the prostate microenvironment to promote prostate tumorigenesis and progression to aggressiveness
21251749 In genetic association studies, no association was found between the IGF-I receptor polymorphisms investigated and endometriosis in a Korean population of women.
21217522 overexpressed in estrogen receptor-positive breast carcinomas
21212273 IGF-1R activation represents a previously unrecognized key pathway involved in the mechanisms by which NT and NTR1 modulate colonic inflammation and inflammatory bowel disease.
21204214 IGF1R mutations may contribute to the risk and in some cases cause single suture craniosynostosis.
21197570 IGF1R expression patterns in epithelial cells of benign breast biopsies were associated with an increased risk of subsequent breast cancer
21177763 Studies provide a clear biological rationale to test anti-IGF-IR/InsR therapy in combination with chemotherapy in patients with TNBC.
21159245 The IGF-IR expression is related to tumor size and T stage in lung adenocarcinoma, while there is no relation between IGF-IR expression and prognosis.
21152401 Findings suggest that Cav-1 and PTRF/Cavin could represent two relevant and distinct targets to modulate IGF-IR function.
21147068 In this study they compared nIGF-1R accumulation in neoplastic and normal cells in relation to expression of IGF-1R and Ubc9.
21139137 Studies indicate that insulin, IGF-1, TrkA, and TrkC receptors as trophic and as dependence receptors.
21124078 small cell lung cancer is characterized by frequent high-IGF1R protein expression, increased gene copy number, and occasional occurrence of true gene amplification.
21123183 Stable IgG-like bispecific antibodies directed toward the type I insulin-like growth factor receptor demonstrate enhanced ligand blockade and anti-tumor activity.
21122407 The excessive activation of the IGF-1R signaling pathway is probably one of the mechanisms that caused resistance of 5-8F/Erbitux cells to cetuximab.
21075859 Dopamine acting through its D(2) receptor, inhibits IGF-I-induced proliferation of gastric adenocarcinoma cells by up-regulating KLF4, a negative regulator of the cell cycle through down regulation of IGF-IR and AKT phosphorylation.
21057462 Increased IGF1R mRNA implies poorer patient prognosis among different breast cancer subtypes
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
21047277 In the present study, we observed associations between the IGF-1/1R pathway, susceptibility to IgAN, and the pathologic progression of childhood IgA nephropathy.
21047277 Observational study of gene-disease association. (HuGE Navigator)
21046444 Observational study of gene-disease association. (HuGE Navigator)
21041409 Data show that Delta40p53 controls the switch from pluripotent ESCs to differentiated somatic cells by controlling the activity of full-length p53 at critical targets such as Nanog and the IGF-1 receptor.
20976540 Report significant up-regulation of Rap1 and IGF-IR in carcinoma in situ progressing to invasive breast cancers.
20962017 The heterozygous mutation described in this study reduced IGF1R expression and represents haploinsufficiency of the IGF1R gene. this mutation leads to abnormalities in the function of IGF1R and also retards intrauterine and subsequent growth.
20950153 RNA interference against IGF-IR successfully inhibited the expression of IGFIR in human OVCAR3 ovarian cancer cells.
20940305 insulin-like growth factor-1 receptor is a binding partner of Loop 6/TIMP
20935157 Observational study of gene-disease association. (HuGE Navigator)
20927124 P. acnes can induce the formation of comedones by stimulating the IGF/IGF-1R system
20871634 Data indicate that RACK1 serves as a direct mediator between loss of pVHL function and enhanced IGF-IR signaling pathway in RCC.
20847162 (111)In-R1507 and (89)Zr-R1507 are new tracers to noninvasively determine IGF-1R expression in vivo in breast cancer xenografts using SPECT and PET.
20837466 SPCA1 inhibites the processing of IGF1R in MDA-MB-231 cells.
20819078 Results demonstrated that miR-7 regulates the IGF1R/Akt signalling pathway by post-transcriptional regulation of IGF1R.
20818434 Rhabdomyosarcoma pathogenesis involves increased IGF1R expression that enhances AKT and Bcl-x(L)-mediated cell survival.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20736806 High expression of IGF-1R is associated with thymic malignancies.
20734064 Observational study of gene-disease association. (HuGE Navigator)
20731749 Data demonstrate a cross-talk between IGF-1R and AT-1R in AT-II and IGF-1-induced Cx43 expression in SV SMCs involving Erk 1/2 and downstream activation of the AP-1 transcription factor.
20713879 Randomized, phase II study of the insulin-like growth factor-1 receptor inhibitor IMC-A12, with or without cetuximab, in patients with cetuximab- or panitumumab-refractory metastatic colorectal cancer.
20673868 Observational study of gene-disease association. (HuGE Navigator)
20670935 The reciprocal regulation of gamma-synuclein and IGF-I receptor expression creates a circuit that modulates IGF-I signaling.
20648549 Studies indicate that inhibiting the IGF-1R signaling pathways early in the carcinogenic process results in reduced cell proliferation and survival, leading to decreased tumor formation.
20644561 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20634197 Meta-analysis of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20620597 hybrid insulin/IGF-I receptor (hybrid-R), which is present in endometrial carcinoma cells, may have an important role in mediating IGF- and insulin-induced cell growth and in preventing apoptosis.
20592355 IGF-1R has a role in primary and metastatic undifferentiated carcinoma of the head and neck
20587610 Observational study of gene-disease association. (HuGE Navigator)
20580999 Observational study of gene-disease association. (HuGE Navigator)
20569071 IGF-IR might be taken as a marker of clone cells in myelodysplastic syndromes
20504360 Resveratrol suppresses colon cancer cell proliferation and elevates apoptosis even in the presence of IGF-1 via suppression of IGF-1R/Akt/Wnt signaling pathways and activation of p53.
20453000 Observational study of gene-disease association. (HuGE Navigator)
20452482 Observational study of gene-disease association. (HuGE Navigator)
20432247 Two functionally distinct allelic forms of the IGR1R Loop3 poly(U)-tract are prevalent in the human population, and it is conceivable that germ-line or somatic variations in this sequence could predispose individuals to development of malignancy
20422977 Overexpression of IGF-IR and PKC may play an important role in the carcinogenesis and development of laryngeal squamous cell carcinoma.
20417685 Results suggest that prostate cancer progression is associated with a decrease in insulin-like growth factor-I receptor (IGF-IR) expression that could be the result of impaired ability of androgen receptors to stimulate IGF-IR gene expression.
20417200 Disruption of IGF-1R signaling increases TRAIL-induced apoptosis
20416304 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20403354 Observational study of gene-disease association. (HuGE Navigator)
20397262 Insulin-like growth factor-I receptor has a role in proliferation and motility of pancreatic cancer
20395438 Data describe the role of the IGF-IR in bladder cancer and show that it required the activation of the Akt and MAPK pathways as well as IGF-I-induced Akt- and MAPK-dependent phosphorylation of paxillin.
20389101 higher IGF-I and IGF-IR contents observed in small for gestational age placentas and the lower contents observed in large for gestational age placentas compared with adequate for gestational age placentas may be influencing human fetal growth.
20360006 IR and IGF1R act as identical portals to the regulation of gene expression, with differences between insulin and IGF-1 effects due to a modulation of the amplitude of the signal created by the specific ligand-receptor interaction
20357178 A novel amino acid substitution in the IGF1R gene resulted in intrauterine and postnatal growth retardation of an affected patient
20351332 In non-small cell lung carcinoma IGF1R protein and gene expression does not associate with survival, whereas high IGF1R gene copy number harbors positive prognostic value.
20351332 Observational study of gene-disease association. (HuGE Navigator)
20347606 IGF1R and IGF2R differential expression may contribute to the increased risk of malignant transformation in young african american (AA) women and to the more aggressive breast cancer phenotype observed among AA breast cancer patients.
20302654 Observational study of gene-disease association. (HuGE Navigator)
20233590 pathological dysregulation of IGF1R translational control may contribute to development and progression of breast cancer, and breast metastasis in particular
20204283 IGF-IR expression in primary breast cancer is an independent favorable prognostic factor.
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20200332 Observational study of gene-disease association. (HuGE Navigator)
20193554 The IGF-1R gene is neither associated with the occurrence nor the curve severity of adolescent idiopathic scoliosis.
20193554 Observational study of gene-disease association. (HuGE Navigator)
20179633 study suggests for the first time a putative role of IGF1R variants in individual susceptibility to metabolic syndrome-related phenotypes, in particular on the risk of having insulin resistance and arterial hypertension
20179633 Observational study of gene-disease association. (HuGE Navigator)
20178321 Data show that 5-benzylidenethiazolidine-2,4-dione and 5-(furan-2-ylmethylene)thiazolidine-2,4-dione were identified as potent and selective IGF-1R inhibitors.
20154720 Notch-1 stimulates survival of lung adenocarcinoma cells during hypoxia by activating the IGF-1R pathway.
20145208 there is a SUMOylation-mediated mechanism of IGF-1R signaling that has potential implications for gene regulation
20131294 Activation of IGFR occurs at least in part via SirT1-mediated repression of PTP1B
20119675 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20104520 overexpression for IGF-1R is associated with adenocarcinoma of the esophagus.
20103837 Anti-IGF-IR antibodies with different epitope-specificities can cause downregulation and internalization of IGF-IR from clathrin-coated pits.
20103656 a novel heterozygous IGF1R mutation identified in a girl with short stature and six relatives was evaluated. results in a kinase-deficient IGF1R, which is likely to cause the phenotype of intrauterine and postnatal growth retardation.
20103628 Results suggest that trastuzumab resistance in breast cancer might be overcome by therapeutic strategies that jointly target erbB3, erbB2, and IGF-IR.
20080972 PRL diminished IGF-I-induced IGF-IR internalization, which may result from reduced SHP-2 association with IGF-IR, because we demonstrated an essential role for SHP-2 in IGF-IR internalization
20078550 These results suggest that IGFR-1 expression may be useful as a prognostic marker in patients with small-cell lung cancer -extensive disease.
20061986 Uveal melanomas express HGF, c-Met, EGFR, and IGF-1R
20061696 A statistically significant correlation was demonstrated between IGF-IR expression and Fuhrman nuclear grading and survival in patients with renal cell carcinoma. However, it seems that IGF-IR cannot be considered as an independent prognostic factor.
20009360 findings indicate that TNF-alpha induces a loss of sensitivity to stimulation by IGF-I, through reducing amount of IGF-I/insulin hybrid receptor and the stimulation of HR tyrosine kinase activity by IGF-I.
19996272 Studies show that BMS-754807 is a reversible inhibitor of the insulin-like growth factor 1 receptor/insulin receptor and increases poly ADP ribose polymerase and Caspase 3 cleavage.
19966862 Studies provide further evidence for a role of the IGF-1R in skin, and imply that reduced expression of IGF-1 in geriatric skin could be an important component in the development of aging-related non-melanoma skin cancer.
19950226 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19877134 findings show that sequence variation in IGF1R may influence insulin secretory function
19877134 Observational study of gene-disease association. (HuGE Navigator)
19874825 Results reveal a link between the IGF-I pathway in PCCs and CCL5 pathway in MSCs through the interaction of those cells.
19855090 Results show that IGF-IR can inhibit PKC-alpha gene transcription and thereby block the synthesis of PMA-regulated MMPs, suggesting that within the same cells, IGF-IR can act as both a positive and negative regulator of MMP expression and function.
19853071 Study we provide evidence of an association between the age-related decline in IGF-I with the progressive decrease in bone formation markers in premenopausal women.
19843326 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19838209 Data show that disruption of IGF1R rendered cells more susceptible to anoikis.
19835884 Taken together, these findings suggest that the structural movements within the receptor upon ligand binding are small and are possibly limited to local rotation of domains.
19834535 Observational study of gene-disease association. (HuGE Navigator)
19817984 insulin action on platelet function in platelets expressing hybrid Insulin/IGF-1 receptors
19812598 Observational study of gene-disease association. (HuGE Navigator)
19806209 In NSCLC cell lines, high levels of total IGF-1R are associated with moderate sensitivity to R1507 (IGF-1R antibody)
19767315 Overexpression of IGF1R is associated with squamous cell carcinoma in non-small-cell lung cancer patients.
19759555 Two single nucleotide polymorphisms of the IGF-1 receptor gene are related to left ventricular hypertrophy in patients with essential hypertension.
19749460 The expression of factor IGF-II and its receptor, IGF-1R was significantly higher in breast carcinoma having Loss of Heterozygosity at WT1 locus.
19713175 results indicate that the levels of placental insulin-like growth factor 2 and insulin-like growth factor I receptor may be involved in the development of macrosomia
19703789 E2F1 expression induced a significant increment in endogenous IGF-IR levels. ChIP assays showed enhanced E2F1-binding to the IGF-IR promoter in E2F1-expressing cells.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19680556 Observational study of gene-disease association. (HuGE Navigator)
19679045 The common IGF-IR gene polymorphism G1013A modulates the risk of obesity for esophageal adenocarcinoma.
19679045 Observational study of gene-disease association. (HuGE Navigator)
19672856 over-expression of IGF1R is associated with Gastrointestinal Stromal Tumors.
19669768 This study indicates that downregulation of IGF-IR results in significant inhibition of tumor growth in vitro.
19664602 FAK-NT2 (a.a. 127-243) domain directly interacts with the N-terminal part of the IGF-1R intracellular domain.
19658040 Observational study of gene-disease association. (HuGE Navigator)
19657367 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19584075 Observational study of gene-disease association. (HuGE Navigator)
19582762 findings suggest that G1013A most likely modulates IGF-IR function, possibly by influencing gene transcription or mRNA stability, and represents a plausible mechanistic link underlying the association between obesity and esophageal malignancy
19578119 the direct binding to IGF-1 to integrin alphavbeta3 plays a role in IGF-1 signaling through ternary complex formation (alphavbeta3-IGF-IGF1R)
19545541 these data suggest a role for FAK in phosphorylation, signaling and stability of the IGF-1R.
19524379 A strong positive correlation between insulin as well as IGF1 receptor and AdipoR1, but not AdipoR2, expression could be observed.
19509240 Data validate IGF1R as a therapeutic target in CC-RCC, and support the evaluation of IGF1R-inhibitory drugs in patients with renal cancer.
19500509 Data suggest that the expression of IGF-1R or VEGF may be related to the development, invasion and metastasis of gastric carcinoma.
19488994 Hassall's corpuscles are involved in the local regulation of T-cell development and thymus plasticity during aging by IGF-I/IGF-IR-mediated cell signaling pathway.
19473988 Findings suggest that increased IGF-I signaling may also be involved in processes leading to retinal vascular pathology in humans.
19460140 A polymorphic variant of the insulin-like growth factor 1 receptor (rs2229765, a minor allele) is found to correlate with male longevity in an Italian population.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19423729 identified novel reciprocal functional interactions between IGF-IR and NPM-ALK
19406106 enhanced IGF-1 signaling inhibits glucose-induced apoptosis in HUVECs by reducing mitochondrial dysfunction, and maintaining the mitochondrial retention of cytochrome-c.
19391107 Data show that IGF-IR resistant to miR145 is not down-regulated by miR145 but fails to rescue colon cancer cells from growth inhibition, and indicate that down-regulation of IRS-1 plays a significant role in the tumor suppressor activity of miR145.
19381485 Increased numbers of IGF-1R-positive cells were found in nasal polyps compared to nasal mucosa in the epithelium & stroma, suggesting involvement of innate immunity in nasal polyp formation.
19351509 Data show that the expression of IGF-IR was positively related with the expression of COX-2 and PCNA.
19330903 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19318572 Treating ovarian cancer with cisplatin showed that enhanced IGF-IR expression and autocrine IGF-I are associated with hyperactivation of the IGF-IR and phosphatidylinositol-3-OH kinase (PI3K) pathways in cisplatin-resistant cells.
19241236 Results shows the preferential IGF-1R immunolocalizatrion in specific areas of the developing embryo, suggesting a role of IGF1-R for the optimal maturation of those areas, during developing human embryos.
19240157 Our findings suggest that more frequent IGF-IR(+) T cells in graves' disease cannot be attributed to genetic determinants
19190347 Regulatory role of IRS-2 on the expression of IGF-IR through PKCdelta in pancreatic cancer cells.
19176870 pIGF-IR is upregulated in a majority of follicular thyroid carcinomas.
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19160858 Over-expression of IGF-1R is related to poor differentiation of nasopharyngeal carcinoma.
19153117 High coexpression of both insulin-like growth factor receptor-1 (IGFR-1) and epidermal growth factor receptor (EGFR) is associated with shorter disease-free survival in resected non-small-cell lung cancer patients.
19139090 Val(43), Phe(28), and Val(14) (equivalent to site 1) are critical to IGF-1R and IR binding, whereas mutation to alanine of Gln(18) affects only IGF-1R and not IR
19136503 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19124510 Observational study of gene-disease association. (HuGE Navigator)
19124506 Observational study of gene-disease association. (HuGE Navigator)
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19033715 Anti-IGF-1R strategies may offer a useful approach in molecular therapy for colorectal cancer, which has the potential to improve outcomes.
19020730 FAK, mTOR and IGF-IR are inhibited by TAE226 in esophageal cancer cells
18992263 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18949375 Co-targeting the EGFR and IGF-IR with anti-EGFR monoclonal antibody ICR62 and the IGF-IR tyrosine kinase inhibitor NVP-AEW541 in colorectal cancer cells.
18938767 The epithelial expression of IGF1R is elevated in mildly active UC.
18931647 Report overexpression of IGF1R in pancreatic islets of nesidioblastosis patients.
18832736 In lymphocytes from patients with GD, IGF-1 enhanced IgG production (p < 0.05) and increased B cell expansion (p < 0.02) in vitro while those from control donors failed to respond
18829558 The divergent signaling functions of IGF1R and EGFR suggested the potential for synergism by a combination of therapy directed at the two receptors.
18788919 IGF-1 receptor signaling alterations could explain thyroid-associated ophthalmopathy [review]
18768899 Insulin-like grow factor 1 receptor associates with thyroid-stimulating hormone receptor in situ; together they may comprise a functional antigenic complex in thyroid and orbital tissue.
18766208 Data provide an immunohistochemical evaluation of insulin-like growth factor I receptor status in cervical cancer specimens.
18723765 The ubiquitin ligase Nedd4 mediates oxidized low-density lipoprotein-induced downregulation of insulin-like growth factor-1 receptor.
18711691 The role of the IGF/insulin receptors in cervical cancer cell lines with different Human papillomavirus (HPV) status, SiHa (HPV positive), and C33a (HPV negative), was assessed.
18708119 Microvascular endothelial cells are sensitive to IGF-I but resistant to insulin due to a preponderance of IGF-I receptors and sequestration of insulin receptors into insulin/IGF-I hybrid receptors.
18693051 IR and IGF-IR are present in human preadipocytes and adipocytes. Differentiation is characterized by an increased IR/IGF-IR ratio.
18683043 Local recurrences of invasive breast carcinoma were associated with high-grade tumors, PR-negative and low active-IGF1R
18676680 Observational study of gene-disease association. (HuGE Navigator)
18660489 Observational study of gene-disease association. (HuGE Navigator)
18636198 Higher IGF-I Receptor is associated with venous invasion and liver metastasis in colorectal cancer.
18636124 Observational study of gene-disease association. (HuGE Navigator)
18632619 c-Cbl is a new ligase for insulin-like growth factor-I receptor with distinct roles from Mdm2 in receptor ubiquitination and endocytosis
18616667 Competitive equilibrium binding assays revealed significantly reduced specific binding to the insulin, IGF-I, and IGF-II and their receptors in both the anterior cingulate and vermis of alcoholic human brains.
18611244 Inhibition of the IGF-IR pathway and aromatase is synergistic in two independent estrogen-dependent in vitro models of breast cancer
18599112 MVP and IGF-1R expression were related in clinical cervical tumours and confer reduced long-term local control in patients who achieved clinical complete response to radiochemotherapy.
18566589 In this crystal structure, the IGF1RK active site is occupied by Tyr1135 from the activation loop of an symmetry (two-fold)-related molecule, allowing visualization of the initial trans-phosphorylation event in the activation loop of an RTK.
18562769 Observational study of gene-disease association. (HuGE Navigator)
18538283 Common IGF1 and IGF1R gene polymorphisms, such as single nucleotide polymorphisms and variable number of tandem repeats, have been investigated with conflicting results with respect to small for gestational age-related outcomes.[review]
18537183 Activation of IGF-II/IGF-IR signaling is likely a progression switch selected by function that promotes tumor cell dissemination and aggressive tumor behavior.
18535748 Suppression of IGF1R gene expression by shRNA enhances the chemosensitivity of A549 cells to DDP both in vitro and in vivo.
18508432 IGF-IR appears to be a critical determinant of response to numerous cancer therapies.[REVIEW]
18492705 ER alpha is involved in activation of ERK/mitogen activated protein kinase by genistein by its early association with IGF-IR, leading to hyper-responsiveness of leiomyoma cells, confirming that ER signaling is enhanced by activation of ERK/MAPK.
18491034 The data suggest that phosphoenolpyruvate -dependent decrease of collagen biosynthesis in cultured human skin fibroblasts may undergo through depression of alpha(2)beta(1) integrin and IGF-IR signaling.
18483367 IGF-IR-positive expression, performance status 1 or 2, and diffuse type tumors were significant predictors of poor survival in gastric cancer.
18477064 The G-A polymorphism in the IGF-1R gene may affect the susceptibility to brain ischemia in the Chinese population.
18477064 Observational study of gene-disease association. (HuGE Navigator)
18469701 A genetic variation at the IGF1R gene locus is associated with spinal disc degeneration, in line with involvement of IGF1R in cartilage metabolism.
18469701 Observational study of gene-disease association. (HuGE Navigator)
18458087 Akt and its downstream targets FoxO3a and GSK3 regulate a survival pathway in VSMCs and that their deregulation due to a reduction of IGF1R signaling may promote apoptosis in atherosclerosis.
18452152 dysregulation of the IGF-IR internal ribosomal entry site through changes in the activities of RNA-binding translation-regulatory proteins could be responsible for IGF-IR overexpression in a proportion of human breast tumors.
18451178 A critical role for IGF-IR signaling in prostate tumorigenesis with an important IGF-IR-dependent growth control mechanism.
18418709 downregulation of type I IGF receptor expression is associated with breast cancer.
18413316 induction of decorin expression in angiogenic, as opposed to quiescent, endothelial cells promotes a motile phenotype in an interstitial collagen I-rich environment by both signaling through IGF-IR and influencing alpha2beta1 integrin activity
18349294 Observational study of gene-disease association. (HuGE Navigator)
18316725 Sequence analysis of the IGF1 and IGF1R genes of female centenarians showed overrepresentation of heterozygous mutations in the IGF1R gene among centenarians that are associated with high serum IGFI levels and reduced activity of the IGFIR
18316725 Observational study of gene-disease association. (HuGE Navigator)
18267106 In conclusion, SS18-SSX and IGF-1R seem to play important but different roles in maintaining malignant growth of synovial sarcoma cells.
18263593 simultaneous inhibition of both Focal adhesion kinase and the insulin-like growth factor-I receptor represents a potential novel therapeutic approach in human pancreatic adenocarcinoma
18249219 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18216278 one mechanism of keratinocyte resistance to UVB-induced carcinogenesis involves the induction of IGF-1R-dependent premature senescence
18196535 MT1-MMP localization and IGF-1R expression in prostate carcinoma could be predictive biomarkers for aggressive disease.
18178561 TRAIL may play an important role in atherosclerosis by regulating IGF1R expression in VSMC in an NF-kappaB-dependent manner.
18095062 Observational study of gene-disease association. (HuGE Navigator)
18095062 IGF-I receptor gene G3174A polymorphism is associated with lumbar spine BMD in postmenopausal Korean women
18079201 Signal transduction pathways underlying the enhanced cell migration reveal that the IGF-I-IGFBP-VN complex stimulates a transient activation of the ERK/MAPK signaling pathway and a sustained activation of the phosphatidylinositide 3-kinase/AKT pathway.
18079194 Altered osteoblast proliferation in human osteoporosis may result from dysregulation of IGF-I receptor signaling, including constitutive activation of the IRS-2/Erk signaling pathway.
18064302 PC furin is a major IGF-1 receptor convertase.
18059487 UVB irradiation leads to an activated p38 MAPK that is regulated in an IGF-1R-dependent manner, leading to NF-kappaB p50:RelA/p65 activation and a survival phenotype.
18050122 The results do not support the association of the most prevalent insulin-like growth factor I receptor gene polymorphism and the risk of advanced retinopathy of prematurity.
17975158 Blocking Hsp90 disrupts IGF-I and IL-6-induced proangiogenic signaling cascades by targeting IGF-IR and STAT3 in pancreatic cancer
17972051 Observational study of gene-disease association. (HuGE Navigator)
17956902 Identification of epitopes of insulin-like growth factor-I receptor recognized by monoclonal antibodies.
17918158 curcumin and FOLFOX work through attenuation of the EGFR and IGF-1R signaling pathways
17899316 IGF-I receptor and beta1-integrin signaling may play an important role in protective effect of hyaluronic acid on interleukin-1-induced inhibition of collagen biosynthesis in cultured human chondrocytes.
17898946 Observational study of gene-disease association. (HuGE Navigator)
17846171 The apoptosis of DNA-damage-induced p53 is reduced in Igf-1r(-/-) mouse embryonic fibroblasts or tumor cells treated with the IGF-1R inhibitor. Furthermore inhibition of IGF-1R reduces p53 and Mdm2 translation through a gene-specific mechanism
17786320 Upregulation of IGF-1 receptor expression is associated with oral cancer.
17766039 Data suggests that the IGF-IR gene is a physiologically relevant downstream target for BRCA1 action.
17761519 Inhibition of IGF1R using a blocking antibody or lentivirus-delivered shRNA reduced hESC self-renewal and promoted differentiation
17724138 Data show that aldosterone increases elastin production via a mineralocorticoid receptor-independent pathway involving insulin-like growth factor-I receptor signaling.
17649826 evidence for the expression of IGF-1R in nerve sheath tumors in NF1
17640993 Different members of Rho GTPase family regulate IGF-II-mediated EVT cell migration differentially, depending upon whether it signals through IGF1R or in an IGF1R-independent manner.
17634559 Overexpression and dimerization with EGF receptor produces a therapeutic targeet in head and neck cancer xenografts.
17627944 Insulin-like growth factor-I receptor mediates the prosurvival effect of fibronectin.
17620336 that endogenous IGF-1 and IGF-2 receptors can independently initiate ERK1/2 signaling and point to a potential physiologic role for IGF-2 receptors in the cellular response to IGF-2
17586502 The juxtamembrane region of IGF1R plays an important role in limiting the basal activity of the receptor.
17568996 Dual targeting of IGF-1R and PDGFR increased cell death in both glioma 18 and glioma 38 cell lines in comparison to inhibition of either receptor alone. In addition, co-inhibition of IGF-1R and PDGFR increased radiosensitivity in 18 cells.
17560756 the two systems, TRs and IGF1/IGF1R could be functionally associated.
17525128 E2 can activate a linear pathway involving the sequential activation of IGF-IR, MMP, HB-EGF, EGFR, and MAPK in MCF-7 breast cancer cells
17524361 This study suggests that the IGF-IR is a substrate for gamma-secretase and may mediate a function independent of its role as a receptor tyrosine kinase.
17486080 VHL inactivation leads to IGF1R upregulation, contributing to renal tumorigenesis and potentially also to chemoresistance.
17442315 Observational study of gene-disease association. (HuGE Navigator)
17442315 Common SNP (GAA1013-->GAG) in the IGF1R gene may be associated with premature pubarche in children.
17419944 The IGF-I/IGF-I-receptor pathway plays an essential role in the development and maintenance of the malignant phenotype by favoring cell survival & inhibiting apoptosis. Review.
17418605 IGF-related peptides are most likely synthesized locally and might be involved in the initiation and/or progression of neointimal thickening of primary arteriovenous fistulas.
17349528 Intense insulin-like growth factor-1 receptor is associated with local and metastatic prostate cancer
17320820 EGFR cannot compensate for IGF1R depletion.
17307140 EGFR depletion induced enhancement of IGF1R ubiquitylation and degradation.
17296734 Overexpression of a constitutively activated IGF-IR (CD8-IGF-IR) was sufficient to cause transformation of immortalized human mammary epithelial cells and growth in immunocompromised mice.
17277889 small interfering RNA for IGF-1R significantly inhibited the formation of lung metastases in nude mice.
17264177 An amino-acid-substitution mutation is postulated to be the cause of intrauterine and postnatal growth retardation in a family.
17196841 Small interferin RNA downregulates this protein and inhibits growth of a breast cancer cell line in vitro and in nude mice.
17164371 Observational study of gene-disease association. (HuGE Navigator)
17145858 Data provide evidence that an increase in IGFIR gene copy number results in aberrant expression in the blastemal compartment of some Wilms' tumors and is associated with an adverse outcome in these patients.
17097318 These results demonstrate that IGF1R is downregulated by P53, and that siRNA targeting of IGF1R increases liver cancer cells sensitivity to adriamycin and promotes apoptosis.
17066319 the expression of IGF-I and IGFIR genes may undergo substantial change over the course of breast tumorigenesis, and the pattern of changes may be associated with breast cancer prognosis
17065200 Luteolin inhibits IGF-1R/AKT signaling, these results provideing a new insight into the mechanisms that luteolin inhibits testicular cancer cells.
17063263 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17063263 polymorphisms in the IGF-1R and IGFBP3 genes, but not IGF-1 or IGFALS, may be associated with altered survival among subgroups of breast cancer patients defined by menopausal status
17044098 Observational study of gene-disease association. (HuGE Navigator)
17016438 Pharmacological intervention against IGF-IR with simultaneous activation of GSK3beta could be highly effective against medulloblastomas
17014845 transcriptional activation of the IGF-IR gene by Cav-1 requires an intact p53 signaling pathway
16983186 Observational study of gene-disease association. (HuGE Navigator)
16981855 Precise orientation of IGF-I within the IGF-I-IGF-1R complex involving the IGF-I C-domain binding to the IGF-1R CR domain.
16981720 These data suggest that IGF-1R and PKCdelta are required to stimulate PKB phosphorylation in response to BMOV in HepG2 cells.
16962112 Differential expression of insulin receptor, IGF-IR, and IGF-I in adhesion fibroblasts may contribute to pathogenesis of fibrosis in diabetic patients.
16891453 IGF-IR and c-Met cooperate to induce migration and invasion of human pancreatic carcinoma cells.
16886151 Observational study of gene-disease association. (HuGE Navigator)
16886151 both IGF1R and the TGF-beta /BMP pathway could play important roles in immune function in sickle cell anemia and their polymorphisms may help identify a "bacteremia-prone" phenotype
16831875 Data show that hybrid receptors formed by insulin receptor (IR) and insulin-like growth factor I receptor (IGF-IR) have low insulin and high IGF-1 affinity irrespective of the IR splice variant.
16827799 IGF1R overexpression might activate pERK1/2 and pAKT in hormone receptor-positive breast cancer, but activate only pAKT in hormone receptor-negative breast cancer.
16805964 IGF-1 receptor kinase is inhibited by hydrogen peroxide
16804965 The up-regulation of IGF-IR expression in hepatocytes of patients with CHC could constitute an attempt to stimulate hepatocyte regeneration.
16793764 Tyr-1135 plays an important role in stabilizing the autoinhibited conformation of the activation loop, while Tyr-1136 plays the key role in stabilizing the open, activated conformation of IGF1R within the tyrosine kinase catalytic domain.
16750336 Weaker placental IGF-1R staining in the placentae of diabetic pregnancies associated with septal hypertrophic cardiomyopathy suggests reduced expression of IGF-1R
16648580 PQ401 inhibits autophosphorylation ofIGF-IR in cultured human breast cancer cells with an IC50 of 12 micromol/L and phosphorylation of the isolated kinase domain of the IGF-IR.
16647191 selected examples of tumor suppressors, including BRCA1, p53, and WT1, whose mechanism of action involves regulation of IGF-IR gene expression. [REVIEW]
16595699 demonstrate significant overexpression of the IGF-IR in human pheochromocytomas
16584539 Breast cancer MCF-10A cells over-expressing the IGFIR formed large, misshapen acinar structures with filled lumina and disrupted apico-basal polarization.
16407661 Serum starvation significantly increases PDGFbeta-R but not IGF-1-R mRNA & protein expression in smooth muscle cells. Distribution of PDGFbeta-Rs & IGF-1-Rs in atherosclerotic lesions may indicate an effect of serum starvation on SMCs in arterial wall.
16362313 Observational study of gene-disease association. (HuGE Navigator)
16362313 Our results do not support the hypothesis that the carrier state of IGF-IR G(+3174)A polymorphism has an impact on the risk of ROP in infants.
16328478 overexpression of IGF-IR exists in hematopoietic cells in myelodysplastic syndrome and acute myeloid leukemia marrows, which appears to contribute to disease progress
16181796 the IGF-IR gene is a novel downstream target for p63/p73 action
16172123 CXCR4 is trans activated by IGF1R in human breast cancer epithelial cells
16127155 Segregation of IGF-IR in and out of lipid rafts may dynamically regulate the pro- and anti-apoptotic effects of IGF-I on apoptosis induced by TNF superfamily members.
16087727 interplay between WT1 and ERalpha in control of IGF-IR gene transcription
16053920 We found that the colon cancer cell lines Caco2, HT29, SW837, and SW480 express high levels of the IGF-1R receptor, and that both SW837 and SW480 cells display constitutive activation of this receptor.
16037379 Existence of unidirectional IGF-IR/EGFR cross-talk mechanism whereby IGF-II, acting through IGF-IR, regulates basal and ligand-activated EGFR signaling and cell proliferation in a c-SRC-dependent manner in tamoxifen-resistant breast cancer.
16035620 high expression level of insulin-like growth factor I receptor is associated with increased expression of transcription factor Sp1 and regional lymph node metastasis of human gastric cancer
16000560 Data suggest that IGF-IR may be involved in the growth of a subset of craniopharyngiomas and points to the possibility of the involvement of IGF-IR inhibitors as a treatment modality.
15954927 In sedentary, clinically stable maintenance hemodialysis patients as compared to sedentary normal individuals, the mRNA levels for IGF-IEa, IGF-II, and the IGF-I receptor are decreased in vastus lateralis muscle
15932773 leptin and the IGF system of IGF-I, IGFBP-2, and IGF-I receptor do not interact directly in a cell culture model of neuroepithelioma cells
15921396 CD221 is aberrantly expressed on human myeloma cells. Higher levels of CD221 are observed in patients & human myeloma cell lines with the most aggressive 14q32 translocations. CD221 expression has a negative prognostic impact in MM patients.
15914670 The function of the ELAV RNA-stability factor HuR as a 5'-UTR-binding protein and dual-purpose translation repressor may be critical for the precise regulation of IGF-IR expression.
15878855 beta-arrestin has a role in ubiquitination and down-regulation of the insulin-like growth factor-1 receptor by acting as adaptor for the MDM2 E3 ligase
15867218 IGF-IR level was lower in gastrinomas of patients who were rendered disease free and increased levels correlated with tumor growth, aggressiveness, extent, and with liver metastases.
15820831 IGF-1 receptor was found in seminal plasma from fertile and infertile men, but no IGF-1 receptor was observed in sperm from patients with a history of more failed fertilization
15805544 OxLDL downregulates IGF-1R via redox-sensitive pathways that are distinct from OxLDL signaling through MAPK- and PPARgamma-involved pathways but may involve a CD36-dependent mechanism
15797461 The IGF-1 Receptor genes has been inactivated by homologous gene targeting.
15689620 Data show that ionizing radiation causes stress-induced activation of insulin-like growth factor-1 receptor-Src-Mek-Erk-Egr-1 signaling that regulates the clusterin pro-survival cascade.
15671548 IGF-1R and the IGF system may have roles in progression of highly malignant soft tissue sarcoma
15638375 association between IGF-IR expression in the primary oral tumours and their stage
15623623 Low levels of insulin-like growth factor type 1 receptor expression at cancer cell membrane is associated with liver metastasis in colorectal cancers
15595626 IGF-I receptor signaling and function in breast cancer is modulated by estrogen receptor alpha
15564321 IGF-I signaling may have a role in altered fetal growth and development
15472208 hyaluronan production is induced by GD-IgG in fibroblasts suggests that the IGF-I receptor and its activating antibodies may represent a key pathway through which important pathogenic events in thyroid-associated ophthalmopathy are mediated.
15358139 Data report that antagonism of the type 1 insulin-like growth factor receptor in combination with inhibitors of the epidermal growth factor receptor synergistically sensitizes human malignant glioma cells to CD95L-induced apoptosis.
15345673 The present data suggests that the IGF-IR gene is a novel downstream target in an ATM-mediated DNA damage response pathway.
15334055 The cyclolignan PPP efficiently inhibits phosphorylation of IGF-1R without interfering with insulin receptor activity.
15256055 Increases in IGF-IR decrease beta1 integrin expression, and enhance cell migration in neuroblastoma cells.
15254679 DICE1 has a growth-suppressing activity and interferes with anchorage-independent growth of IGF-IR transformed tumor cells dependent upon IGF-I signaling
15253384 an interrelationship is now known to exist between the IGF and EGF receptors [review]
15205474 Activation of IGF-1R by the chimeras reflected their binding affinities whereas the phosphorylation of the two insulin receptor isoforms was more complex.
15181035 Observational study of gene-disease association. (HuGE Navigator)
15127203 Observational study of gene-disease association. (HuGE Navigator)
15103018 The mRNA expression levels for alpha-tubulin, TRADD, IFN-gamma R2, GAS1, MADD, NF-kappaB, I-kappa B, 14-3-3 protein, APaf1, PARP, IGF-1 receptor, RB1, Rb2/p130, ARC, and caspase 6 are upregulated in human neuronal cells after treatment with HIV-1 gp120
15059221 All squamous cell carcinomas and basal cell carcinomas were negative for IGF-IR expression. Six of seven Merkel cell carcinomas stained with IGF-IR strongly, showing cell membrane accentuation and a perinuclear dot-like pattern.
15043778 Observational study of gene-disease association. (HuGE Navigator)
14973173 Data show that differentiated thyroid cancers of children and adolescents express IGF-I and IGF-I receptors.
14769130 muscarinic receptors may inhibit insulin signalling by promoting IRS-1 tyrosine dephosphorylation and/or by uncoupling IRS-1 from the stimulated IGF-1 receptor by stimulating IRS-1 serine phosphorylation
14764897 Shc and IGF-1R serve as key elements in the translocation of ERalpha to the cell membrane and in the facilitation of ERalpha-mediated rapid E2 action
14744783 IGFBP-3 inhibits IGF-I-mediated IGF type 1 receptor (IGF-IR) phosphorylation in 3t3 cells overexpessing human IGF1R
14737113 overexpressing PTEN demonstrated that PC3 cells synthesize significantly lower levels of the IGF-IR precursor
14729630 Compounds with inhibitory effects on IGF-1R may be useful in development of anticancer agents.
14726697 PI3K/Akt and Raf/MEK/ERK pathways are intimately involved in IGF-1R-mediated cell cycle progression and prevention of apoptosis in hematopoietic cells
14722023 Human micro- and macrovascular endothelial cells express more IGF-IR than insulin receptor.
14710368 Ability of a monoclonal antibody to down-regulate the receptor may be an important antibody property in targeting the insulin-like growth factor-I receptor for the treatment of certain cancers.
14710366 Single chain humanized antibody treatment down-regulated IGF-IR which appears to contribute to breast tumor growth inhibition.
14710360 IGF-IR was expressed in primary breasttumors as well as in lymph node metastases, but the expression in primary tumors was more frequent
14710359 Expression in breast cancer correlates with estrogen receptors alpha ansd beta.
14710355 Transcription of the IGF-IR gene is under inhibitory control by a number of transcription factors with tumor suppressor activity, including BRCA1 and p53.
14710354 Activation of IGF-I receptor can selectively enhance the previously reported IGF-I receptor pro-apoptotic signaling pathways.
14697248 IGF-IR mediated attenuation of antineoplastic agent-induced growth inhibition is dependent on IGF-I-induced PI3K signaling rather than IGF-I-induced MAPK signaling
14691011 IGF I receptor is involved in apoptosis protection in human preadipocytes and adipocytes.
14657428 Observational study of gene-disease association. (HuGE Navigator)
14654552 Coexpression of insulin receptor-related receptor and insulin-like growth factor 1 receptor correlates with enhanced apoptosis and dedifferentiation in human neuroblastomas.
14651979 These findings suggest that 14-3-3 proteins interact with the IGFIR in vivo and that this interaction may play a role in a transformation pathway signaled by the IGFIR.
14633695 The IGF1-R/Akt/Bcl-x(L) pathway may contribute to a more aggressive malignant phenotype, in a subset of colorectal cancers.
14627343 role of IGF-1R and c-Src in human pancreatic carcinogenesis. Coexpression of both these molecules may play important role in transformation of pancreatic ductal cells.
14615489 To further understand the role of the type I insulin-like growth factor (IGF) receptor (IGF1R) in cancer metastasis we inhibited signaling via IGF1R using a C-terminal-truncated IGF1R.
14597618 role of IGF1 in cardiac myocytes in the absence of secondary effects, and downstream signaling pathways and transcriptional regulatory effects of the IGF1 receptor
14575710 results suggest a novel regulatory role of the C-terminus of IGF-IR in mediating cellular radioresistance that may be independent of survival signals transmitted through this receptor
14559999 results suggest a novel function for the IGF-IR/IRS-1 pathway that involves regulation of the intracellular trafficking of Rad51 to the site of damaged DNA-a crucial step in the process of DNA repair by homologous recombination
14551153 IGF-1 receptor activation inhibits oxidized LDL-induced cytochrome C release and apoptosis through the phosphatidylinositol 3-kinase/Akt signaling pathway.
12937141 In IGF-IR dominant negative cells decrease in constitutive and inducible phosphorylation of IGF-IR and Erk1/2. Nuclear hypoxia-inducible factor-1alpha and secreted VEGF protein levels also significantly lower.
12884909 IGF binding to the IGF1R initiates an intracellular signaling cascade in breast neoplasms that leads to changes in gene expression and cell biology [review]
12876069 Ligand activation of IGF-1R protects normal human mesangial cells from glycol-oxidant-induced apoptosis program. IGF-1R-activated ERK signaling phosphorylates Ser112 of mitochondrial Bad protein, linking IGF-1R with mitochondrial survival.
12843179 human longevity are coregulated by an overlapping set of genes, contributing to the hypothesis that the impact of the IGF-I/insulin pathway on longevity is a property that has been evolutionarily conserved throughout the animal kingdom.
12821780 Mdm2 physically associates with IGF-1R and that Mdm2 causes IGF-1R ubiquitination in an in vitro assay. Mdm2 serves as a ligase in ubiquitination of the IGF-1R and thereby causes its degradation by the proteasome system.
12820418 Overexpressed and activated IGF1-R may increase the degree of transformation and motility of colon cancer cells by activating c-Src.
12784091 Down- and up-regulation suggests that restoration of IGF-1R would be the result of receptor recycling and de novo synthesis and highlights its importance for T lymphocyte proliferation.
12644306 Ribonucleoprotein complex assembly on the 5'-untranslated region of the IGF-IR transcript.
12634644 Shrinkage in uterine volume induced by GnRH analogs seems to be related to reduction in IGF-I-R levels. IGF-I/IGF-I-R system might affect leiomyoma growth. Action of GnRH analogs on uterine leiomyomas might be related to the effects on IGF-I-R expression.
12613967 First demonstration of insulin-like growth factor-I receptor on human ocular surface.
12603530 IGF-IR and IGF-IIR antisense genes could significantly restrain the malignant behavior of human hepatoma cells and might be useful in investigating a potential route for hepatocellular carcinoma gene therapy.
12593846 signaling pathways mediated by insulin-like growth factor-I receptor are required for proliferation, invasion, and VPF/VEGF expression in a pancreatic carcinoma cell line
12556535 This receptor signals the inhibitor of apoptosis ASK1.
12493743 IGF-IR-mediated radioresistant signaling mechanism progresses through redundant downstream pathways
12483226 IGF-1 receptor regulates lifespan and resistance to oxidative stress in mice
12482592 IGF-1 receptor undergoes serine autophosphorylation and binds to 14-3-3
12444079 WT1-p53 interactions in gene regulation
12379772 affects angiogenesis, growth, and metastasis of colon cancer
12147227 expression at normal levels in Nijmegen breakage syndrome cells
12138114 The x-ray structure of the unactivated kinase domain of insulin-like growth factor-1 receptor (IGFRK-0P) is reported here at 2.7 A resolution.
12138094 Insulin-IGF1 hybrid receptors have different tissue-specific responses based on their isoforms
12127559 Autocrine production of IGF-I and IGF-II may via IGF-IR play a significant role in the growth and megakaryocytic differentiation of K562 cells.
12105987 results suggest a pathway of cancer cell adaptation to the tumor microenvironment in which conditions of the environment may induce expression of IGF1R, and this subsequent overexpression of the receptor may increase cell survival in such conditions
12031683 results suggest that activation promotes neuroblastoma cell proliferation by regulating trans-membrane amino acid transport
12005306 cDNA probes were used to analyze the gene expression of IGF-I receptor in luteinized granulosa cells from different-sized follicles after ovarian hyperstimulation.
11867942 Functional insulin-like growth factor-1/insulin-like growth factor-1 receptor-mediated circuit in human and murine thymic epithelial cells.
11782378 Insulin-like growth factor receptor I mediates resistance to anti-epidermal growth factor receptor therapy in primary human glioblastoma cells through continued activation of phosphoinositide 3-kinase signaling.
11694888 X ray structure and autoregulation of the insulin-like growth factor 1 receptor kinase
9857239 IGF-1 and IGF-1 receptor may be involved in the pathogenesis of Graves' disease; IGF-1 and IGF-1 receptor act by different mechanisms (paracrine vs. autocrine) as suggested by their differential expression in epithelial and stromal cells.

AA Sequence

MKSGSGGGSPTSLWGLLFLSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGYLHILLISKAEDY      1 - 70
RSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIFEMTNLKDIGLYNLRNITRGA     71 - 140
IRIEKNADLCYLSTVDWSLILDAVSNNYIVGNKPPKECGDLCPGTMEEKPMCEKTTINNEYNYRCWTTNR    141 - 210
CQKMCPSTCGKRACTENNECCHPECLGSCSAPDNDTACVACRHYYYAGVCVPACPPNTYRFEGWRCVDRD    211 - 280
FCANILSAESSDSEGFVIHDGECMQECPSGFIRNGSQSMYCIPCEGPCPKVCEEEKKTKTIDSVTSAQML    281 - 350
QGCTIFKGNLLINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRLILGEEQLEGNYSF    351 - 420
YVLDNQNLQQLWDWDHRNLTIKAGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINTRNNGERASCES    421 - 490
DVLHFTSTTTSKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVTEYDGQDACGSNSWNMVDVDLPPNK    491 - 560
DVEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSEILYIRTNASVPSIPLDVLSASNSSSQLIVK    561 - 630
WNPPSLPNGNLSYYIVRWQRQPQDGYLYRHNYCSKDKIPIRKYADGTIDIEEVTENPKTEVCGGEKGPCC    631 - 700
ACPKTEAEKQAEKEEAEYRKVFENFLHNSIFVPRPERKRRDVMQVANTTMSSRSRNTTAADTYNITDPEE    701 - 770
LETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTW    771 - 840
EPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSL    841 - 910
SGNGSWTDPVFFYVQAKTGYENFIHLIIALPVAVLLIVGGLVIMLYVFHRKRNNSRLGNGVLYASVNPEY    911 - 980
FSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNE    981 - 1050
ASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIA   1051 - 1120
DGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFT   1121 - 1190
TYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFL   1191 - 1260
EIISSIKEEMEPGFREVSFYYSEENKLPEPEELDLEPENMESVPLDPSASSSSLPLPDRHSGHKAENGPG   1261 - 1330
PGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC                                    1331 - 1367
//

Text Mined References (845)

PMID Year Title
27172746 2016 Positive expression of insulin-like growth factor-1 receptor is associated with a positive hormone receptor status in ovarian cancer.
27048245 2016 Activation of IGF1R/p110?/AKT/mTOR confers resistance to ?-specific PI3K inhibition.
26991004 2016 Potency of Full-Length MGF to Induce Maximal Activation of the IGF-I R Is Similar to Recombinant Human IGF-I at High Equimolar Concentrations.
26910308 2016 Essential Role of IGFIR in the Onset of Male Brown Fat Thermogenic Function: Regulation of Glucose Homeostasis by Differential Organ-Specific Insulin Sensitivity.
26862994 2016 Development of a Quantitative PCR Assay for Detection of Human Insulin-Like Growth Factor Receptor and Insulin Receptor Isoforms.
26862168 2016 Endogenous dendritic cells from the tumor microenvironment support T-ALL growth via IGF1R activation.
26850678 2016 Preclinical and first-in-human phase I studies of KW-2450, an oral tyrosine kinase inhibitor with insulin-like growth factor receptor-1/insulin receptor selectivity.
26845446 2016 MicroRNA-133a Inhibits Osteosarcoma Cells Proliferation and Invasion via Targeting IGF-1R.
26826001 2016 Hepatic IGF-1R overexpression combined with the activation of GSK-3? and FOXO3a in the development of liver cirrhosis.
26801096 2016 Insulin-like growth factors are essential to prevent anoikis in oestrogen-responsive breast cancer cells: importance of the type I IGF receptor and PI3-kinase/Akt pathway.
26760116 2016 Low Oxygen Tension Modulates the Insulin-Like Growth Factor-1 or -2 Signaling via Both Insulin-Like Growth Factor-1 Receptor and Insulin Receptor to Maintain Stem Cell Identity in Placental Mesenchymal Stem Cells.
26745129 2015 Expression and Clinical Significance of Sushi Domain- Containing Protein 3 (SUSD3) and Insulin-like Growth Factor-I Receptor (IGF-IR) in Breast Cancer.
26738606 2016 Insulin-like growth factor 1 receptor expression and IGF1R 3129G?>?T polymorphism are associated with response to neoadjuvant chemotherapy in breast cancer patients: results from the NEOZOTAC trial (BOOG 2010-01).
26708715 2016 Tumor suppressor role of miR-217 in human epithelial ovarian cancer by targeting IGF1R.
26670433 2015 Effects of insulin-like growth factor 1 receptor and its inhibitor AG1024 on the progress of lung cancer.
26656446 2015 MiRNA-323-5p Promotes U373 Cell Apoptosis by Reducing IGF-1R.
26655273 2016 MicroRNA-122 confers sorafenib resistance to hepatocellular carcinoma cells by targeting IGF-1R to regulate RAS/RAF/ERK signaling pathways.
26648141 2015 let-7a and its target, insulin-like growth factor 1 receptor, are differentially expressed in recurrent prostate cancer.
26584640 2016 mTORC2 promotes type I insulin-like growth factor receptor and insulin receptor activation through the tyrosine kinase activity of mTOR.
26563994 2015 DNA Methylation Changes in the IGF1R Gene in Birth Weight Discordant Adult Monozygotic Twins.
26554827 2016 p73 and IGF1R Regulate Emergence of Aggressive Cancer Stem-like Features via miR-885-5p Control.
26554308 2015 Implication of epithelial-mesenchymal transition in IGF1R-induced resistance to EGFR-TKIs in advanced non-small cell lung cancer.
26536657 2015 HRD1 suppresses the growth and metastasis of breast cancer cells by promoting IGF-1R degradation.
26497996 2015 IGF-1R inhibition induces schedule-dependent sensitization of human melanoma to temozolomide.
26463630 2015 Dual treatments targeting IGF-1R, PI3K, mTORC or MEK synergize to inhibit cell growth, induce apoptosis, and arrest cell cycle at G1 phase in MDA-MB-231 cell line.
26450156 2015 Inhibition of IGF1-R overcomes IGFBP7-induced chemotherapy resistance in T-ALL.
26438154 2015 BI 885578, a Novel IGF1R/INSR Tyrosine Kinase Inhibitor with Pharmacokinetic Properties That Dissociate Antitumor Efficacy and Perturbation of Glucose Homeostasis.
26430715 2015 Increased insulin-like growth factor 1 receptor (IGF1R) expression in small cell lung cancer and the effect of inhibition of IGF1R expression by RNAi on growth of human small cell lung cancer NCI-H446 cell.
26342551 2015 Reduced expression of EI24 confers resistance to gefitinib through IGF-1R signaling in PC9 NSCLC cells.
26337161 2016 Clinical significance of IGF1R gene expression in patients with Stage II/III gastric cancer who receive curative surgery and adjuvant chemotherapy with S-1.
26311784 2015 IGF-1R Reduction Triggers Neuroprotective Signaling Pathways in Spinal Muscular Atrophy Mice.
26304632 2015 Association Study of GWAS-Derived Loci with Height in Brazilian Children: Importance of MAP3K3, MMP24 and IGF1R Polymorphisms for Height Variation.
26297545 2015 miR-99b suppresses IGF-1R expression and contributes to inhibition of cell proliferation in human epidermal keratinocytes.
26297026 2015 Insulin and IGF1 signalling pathways in human astrocytes in vitro and in vivo; characterisation, subcellular localisation and modulation of the receptors.
26291053 2015 IGF-IR: a new prognostic biomarker for human glioblastoma.
26286172 2015 Insulin growth factor-1 (IGF-1) enhances hippocampal excitatory and seizure activity through IGF-1 receptor-mediated mechanisms in the epileptic brain.
26252249 2015 A New Homozygous IGF1R Variant Defines a Clinically Recognizable Incomplete Dominant form of SHORT Syndrome.
26232605 2015 Molecular biomarkers for prediction of response to treatment and survival in triple negative breast cancer patients from Egypt.
26211576 2015 Knockdown of type I insulin-like growth factor receptor inhibits human colorectal cancer cell growth and downstream PI3K/Akt, WNT/?-catenin signal pathways.
26191333 2015 The role of EphB4 and IGF-IR expression in breast cancer cells.
26183824 2015 Poly(ADP-ribose) polymerase as a novel regulator of 17?-estradiol-induced cell growth through a control of the estrogen receptor/IGF-1 receptor/PDZK1 axis.
26173023 2015 IGF1R- and ROR1-Specific CAR T Cells as a Potential Therapy for High Risk Sarcomas.
26165226 2015 Expression and clinical significance of epidermal growth factor receptor and insulin-like growth factor receptor 1 in patients with ampullary adenocarcinoma.
26156803 2015 MicroRNA-133a functions as a tumor suppressor by targeting IGF-1R in hepatocellular carcinoma.
26148588 The expression difference of insulin-like growth factor 1 receptor in breast cancers with or without diabetes.
26138883 2015 Caveolin-1 Confers Resistance of Hepatoma Cells to Anoikis by Activating IGF-1 Pathway.
26112748 2015 PTEN regulates IGF-1R-mediated therapy resistance in melanoma.
26097570 2015 MicroRNA-139-5p inhibits cell proliferation and invasion by targeting insulin-like growth factor 1 receptor in human non-small cell lung cancer.
26089099 2015 H19 lncRNA alters stromal cell growth via IGF signaling in the endometrium of women with endometriosis.
26082409 2015 Absence or low IGF-1R-expression in esophageal adenocarcinoma is associated with tumor invasiveness and radicality of surgical resection.
26075254 2015 Deguelin induces apoptosis by targeting both EGFR-Akt and IGF1R-Akt pathways in head and neck squamous cell cancer cell lines.
26025408 2015 MiR-30a suppresses non-small cell lung cancer progression through AKT signaling pathway by targeting IGF1R.
26012212 2013 [Significance and contribution to the diagnosis of multiple myeloma according to the IGF1-R gene expression profile].
25916750 2015 Insulin-like growth factor-1 receptor is associated with better prognosis in classical Hodgkin's lymphoma: Correlation with MET expression.
25896444 2015 IGF-1R expression is associated with HPV-negative status and adverse survival in head and neck squamous cell cancer.
25884514 2015 The transcription factors Ik-1 and MZF1 downregulate IGF-IR expression in NPM-ALK? T-cell lymphoma.
25862373 2015 Metformin inhibits the proliferation of human prostate cancer PC-3 cells via the downregulation of insulin-like growth factor 1 receptor.
25852271 2015 Insulin-like growth factor-1 mRNA isoforms and insulin-like growth factor-1 receptor mRNA expression in chronic hepatitis C.
25824321 2015 Transforming growth factor-?, insulin-like growth factor I/insulin-like growth factor I receptor and vascular endothelial growth factor-A: prognostic and predictive markers in triple-negative and non-triple-negative breast cancer.
25786252 2015 Insulin growth factor 1 receptor expression is associated with NOTCH1 mutation, trisomy 12 and aggressive clinical course in chronic lymphocytic leukaemia.
25780292 2015 Tumor suppressor role of miR-133a in gastric cancer by repressing IGF1R.
25758790 2015 The insulin and IGF1 receptor kinase domains are functional dimers in the activated state.
25739014 2015 A pleiotropic effect of the single clustered hepatic metastamiRs miR-96-5p and miR-182-5p on insulin-like growth factor II, insulin-like growth factor-1 receptor and insulin-like growth factor-binding protein-3 in hepatocellular carcinoma.
25693948 2015 Adipogenic Differentiation of hMSCs is Mediated by Recruitment of IGF-1r Onto the Primary Cilium Associated With Cilia Elongation.
25693802 2015 Quantitative phosphoproteomics analysis reveals a key role of insulin growth factor 1 receptor (IGF1R) tyrosine kinase in human sperm capacitation.
25680198 2015 Upregulation of IGF-1R expression during neoadjuvant therapy predicts poor outcome in breast cancer patients.
25619494 2015 Differences in IGF-axis protein expression and survival among multiethnic breast cancer patients.
25617986 2015 Expression of insulin-like growth factor 1 receptor (IGF-1R) predicts poor responses to epidermal growth factor receptor (EGFR) tyrosine kinase inhibitors in non-small cell lung cancer patients harboring activating EGFR mutations.
25613038 2015 Prognostic and predictive role of CXCR4, IGF-1R and Ezrin expression in localized synovial sarcoma: is chemotaxis important to tumor response?
25609710 2015 MiR-145 suppresses embryo-epithelial juxtacrine communication at implantation by modulating maternal IGF1R.
25604425 2015 Specific insulin/IGF1 hybrid receptor activation assay reveals IGF1 as a more potent ligand than insulin.
25593300 2015 Next-Gen Sequencing Exposes Frequent MED12 Mutations and Actionable Therapeutic Targets in Phyllodes Tumors.
25564572 2015 Activation of IL6/IGFIR confers poor prognosis of HBV-related hepatocellular carcinoma through induction of OCT4/NANOG expression.
25556445 2014 MiR-323-5p acts as a tumor suppressor by targeting the insulin-like growth factor 1 receptor in human glioma cells.
25520502 2015 LMP1 promotes expression of insulin-like growth factor 1 (IGF1) to selectively activate IGF1 receptor and drive cell proliferation.
25492481 2015 Involvement of miR-143 in cisplatin resistance of gastric cancer cells via targeting IGF1R and BCL2.
25483727 2015 Basal expression of insulin-like growth factor 1 receptor determines intrinsic resistance of cancer cells to a phosphatidylinositol 3-kinase inhibitor ZSTK474.
25474488 2014 MiR-143 and MiR-145 regulate IGF1R to suppress cell proliferation in colorectal cancer.
25473182 2014 Insulin-like growth factor receptor-1 overexpression is associated with poor response of rectal cancers to radiotherapy.
25446090 2014 Treatment with insulin-like growth factor 1 receptor inhibitor reverses hypoxia-induced epithelial-mesenchymal transition in non-small cell lung cancer.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25425114 2015 Evaluation of 99mTc-Z IGF1R:4551-GGGC affibody molecule, a new probe for imaging of insulin-like growth factor type 1 receptor expression.
25416956 2014 A proteome-scale map of the human interactome network.
25400749 2014 Insulin-like growth factor receptor 1 (IGF1R) expression and survival in non-small cell lung cancer patients: a meta-analysis.
25394492 2014 MicroRNA-7 directly targets insulin-like growth factor 1 receptor to inhibit cellular growth and glucose metabolism in gliomas.
25391374 2015 Insulin-like growth factor-1 receptor signaling increases the invasive potential of human epidermal growth factor receptor 2-overexpressing breast cancer cells via Src-focal adhesion kinase and forkhead box protein M1.
25388513 2015 Suppression of homologous recombination sensitizes human tumor cells to IGF-1R inhibition.
25381040 2015 EGFR and IGF-1R in regulation of prostate cancer cell phenotype and polarity: opposing functions and modulation by T-cadherin.
25362932 2014 Association between insulin-like growth factor-1 receptor (IGF1R) negativity and poor prognosis in a cohort of women with primary breast cancer.
25348345 2014 Phosphorylated insulin-like growth factor-1 receptor expression predicts poor prognosis of Chinese patients with gastric cancer.
25344917 2014 TM4SF4 overexpression in radiation-resistant lung carcinoma cells activates IGF1R via elevation of IGF1.
25341922 2015 Insulin activates EGFR by stimulating its interaction with IGF-1R in low-EGFR-expressing TNBC cells.
25339573 2015 Silencing insulin-like growth factor-1 receptor expression inhibits gastric cancer cell proliferation and invasion.
25322858 2014 P-cadherin potentiates ligand-dependent EGFR and IGF-1R signaling in dysplastic and malignant oral keratinocytes.
25305490 2014 MicroRNA let-7i induced autophagy to protect T cell from apoptosis by targeting IGF1R.
25274331 2014 Let-7b-5p regulates proliferation and apoptosis in multiple myeloma by targeting IGF1R.
25268741 2014 Picropodophyllin causes mitotic arrest and catastrophe by depolymerizing microtubules via insulin-like growth factor-1 receptor-independent mechanism.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25241146 2015 Additive impact of HER2-/PTK6-RNAi on interactions with HER3 or IGF-1R leads to reduced breast cancer progression in vivo.
25211187 2014 Human GH receptor-IGF-1 receptor interaction: implications for GH signaling.
25189651 2014 Association of insulin-like growth factor-I receptor polymorphism with colorectal cancer development.
25187374 2015 Genome-wide association meta-analysis identifies novel variants associated with fasting plasma glucose in East Asians.
25184138 2014 miR-375 suppresses IGF1R expression and contributes to inhibition of cell progression in laryngeal squamous cell carcinoma.
25175038 2014 Assessment of insulin-like growth factor 1 receptor as an oncogene in esophageal squamous cell carcinoma and its potential implication in chemotherapy.
25153223 2015 Novel heterozygous IGF1R mutation in two brothers with developing impaired glucose tolerance.
25119174 2014 Expression of insulin-like growth factor receptor type 1 correlate with lymphatic metastases in human gastric cancer.
25118293 2014 Alterations of insulin-like growth factor-1 receptor gene copy number and protein expression are common in non-small cell lung cancer.
25117070 2014 MicroRNA-320a suppresses in GBM patients and modulates glioma cell functions by targeting IGF-1R.
25115504 2014 Analysis of the quantitative balance between insulin-like growth factor (IGF)-1 ligand, receptor, and binding protein levels to predict cell sensitivity and therapeutic efficacy.
25110710 2014 Amplification of the insulin-like growth factor 1 receptor gene is a rare event in adrenocortical adenocarcinomas: searching for potential mechanisms of overexpression.
25096247 2014 microRNA-194 suppresses osteosarcoma cell proliferation and metastasis in vitro and in vivo by targeting CDH2 and IGF1R.
25092925 2014 A novel antisense long noncoding RNA within the IGF1R gene locus is imprinted in hematopoietic malignancies.
25090459 2014 Activated cMET and IGF1R-driven PI3K signaling predicts poor survival in colorectal cancers independent of KRAS mutational status.
25081930 2015 Relevance of insulin-like growth factor 1 receptor gene expression as a prognostic factor in non-small-cell lung cancer.
25081697 2014 Lack of any prognostic role of insulin-like growth factor-1 receptor in non-small cell lung cancer.
25053419 2014 GSK3 protein positively regulates type I insulin-like growth factor receptor through forkhead transcription factors FOXO1/3/4.
25050889 2014 IGF-IR signal transduction protein content and its activation by IGF-I in human placentas: relationship with gestational age and birth weight.
25040157 2015 Three novel IGF1R mutations in microcephalic patients with prenatal and postnatal growth impairment.
25017244 2014 Reduced insulin-like growth factor I receptor and altered insulin receptor isoform mRNAs in normal mucosa predict colorectal adenoma risk.
24999547 2014 Expression of insulin-like growth factor-1 receptor in conventional cutaneous squamous cell carcinoma with different histological grades of differentiation.
24999188 2014 MicroRNA-145 directly targets the insulin-like growth factor receptor I in human bladder cancer cells.
24997432 2014 IGF1R tyrosine kinase inhibitor enhances the cytotoxic effect of methyl jasmonate in endometrial cancer.
24973425 2014 Functional genetic approach identifies MET, HER3, IGF1R, INSR pathways as determinants of lapatinib unresponsiveness in HER2-positive gastric cancer.
24970814 2014 Engineered ubiquitin ligase PTB-U-box targets insulin/insulin-like growth factor receptor for degradation and coordinately inhibits cancer malignancy.
24956249 2014 No association between genetic or epigenetic variation in insulin growth factors and antipsychotic-induced metabolic disturbances in a cross-sectional sample.
24939178 2014 Regulation of SOD2 and ?-arrestin1 by interleukin-6 contributes to the increase of IGF-1R expression in docetaxel resistant prostate cancer cells.
24922664 2014 Insulin-like growth factor receptor 1 mRNA expression as a prognostic marker in advanced non-small cell lung cancer.
24909165 2015 Nuclear translocation of IGF-1R via p150(Glued) and an importin-?/RanBP2-dependent pathway in cancer cells.
24874051 2014 MiR-195 inhibits the growth and metastasis of NSCLC cells by targeting IGF1R.
24870578 2015 Leukocyte IGF-1 receptor expression during muscle recovery.
24811788 2014 Epigenetic dysregulation of the IGF system in placenta of newborns exposed to maternal impaired glucose tolerance.
24810113 2014 IGF-1R, a target of let-7b, mediates crosstalk between IRS-2/Akt and MAPK pathways to promote proliferation of oral squamous cell carcinoma.
24809702 2014 Targeting insulin-like growth factor 1 receptor inhibits pancreatic cancer growth and metastasis.
24809298 2014 Oncogenic functions of IGF1R and INSR in prostate cancer include enhanced tumor growth, cell migration and angiogenesis.
24801045 2014 First pregnancy events and future breast density: modification by age at first pregnancy and specific VEGF and IGF1R gene variants.
24770843 2014 Decreased proliferative capacity of aged dermal fibroblasts in a three dimensional matrix is associated with reduced IGF1R expression and activation.
24758241 2014 Association of IGF1R polymorphisms with the development of HBV-related hepatocellular carcinoma.
24751329 2014 mRNA expression of IGF-1 and IGF-1R in patients with colorectal adenocarcinoma and type 2 diabetes.
24745653 2015 IGF-I receptor 275124A>C (rs1464430) polymorphism and athletic performance.
24745618 2014 Insulin-like growth factor 1 pathway mutations and protein expression in resected non-small cell lung cancer.
24745611 2014 Identification of novel predictive markers for the prognosis of pancreatic ductal adenocarcinoma.
24713135 2014 Insulin-like growth factor-1 receptor overexpression is associated with outcome in invasive urothelial carcinoma of urinary bladder: a retrospective study of patients treated using radical cystectomy.
24683100 2014 Biological effects of insulin and its analogs on cancer cells with different insulin family receptor expression.
24667580 2014 Insulin-like growth factor 1 receptor (IGF-1R) as a target of MiR-497 and plasma IGF-1R levels associated with TNM stage of pancreatic cancer.
24655723 2014 miR-630 targets IGF1R to regulate response to HER-targeting drugs and overall cancer cell progression in HER2 over-expressing breast cancer.
24637962 2014 Differential expression of the insulin-like growth factor receptor among early breast cancer subtypes.
24599933 2014 Id1-induced IGF-II and its autocrine/endocrine promotion of esophageal cancer progression and chemoresistance--implications for IGF-II and IGF-IR-targeted therapy.
24571711 2014 Epigenetic silencing of miR-375 induces trastuzumab resistance in HER2-positive breast cancer by targeting IGF1R.
24489919 2014 Insulin-like growth factor 1 receptor is a prognostic factor in classical Hodgkin lymphoma.
24489728 2014 Hypoxia increases gefitinib-resistant lung cancer stem cells through the activation of insulin-like growth factor 1 receptor.
24458568 2014 The insulin-like growth factor 1 receptor causes acquired resistance to erlotinib in lung cancer cells with the wild-type epidermal growth factor receptor.
24438088 2014 The novel IGF-IR/Akt-dependent anticancer activities of glucosamine.
24410957 2014 Reciprocal regulation of microRNA-99a and insulin-like growth factor I receptor signaling in oral squamous cell carcinoma cells.
24392142 2014 Association of polymorphisms and haplotypes in the insulin-like growth factor 1 receptor (IGF1R) gene with the risk of breast cancer in Korean women.
24379526 2013 Gene expression of IGF1, IGF1R, and IGFBP3 in epiretinal membranes of patients with proliferative diabetic retinopathy: preliminary study.
24378652 2014 MicroRNA-503 acts as a tumor suppressor in glioblastoma for multiple antitumor effects by targeting IGF-1R.
24354797 2014 Expression of insulin-like growth factor-1 receptor in metastatic uveal melanoma and implications for potential autocrine and paracrine tumor cell growth.
24351920 2013 Expression of the IGF-1, IGFBP-3 and IGF-1 receptors in dental pulp stem cells and impacted third molars.
24336871 2014 Tissue factor/factor VIIa induces cell survival and gene transcription by transactivation of the insulin-like growth factor 1 receptor.
24324762 2013 Decoy oligonucleotide rescues IGF1R expression from MicroRNA-223 suppression.
24307738 2014 Platelet-secreted microRNA-223 promotes endothelial cell apoptosis induced by advanced glycation end products via targeting the insulin-like growth factor 1 receptor.
24285539 2014 Liver kinase B1 expression promotes phosphatase activity and abrogation of receptor tyrosine kinase phosphorylation in human cancer cells.
24282274 2014 MM-141, an IGF-IR- and ErbB3-directed bispecific antibody, overcomes network adaptations that limit activity of IGF-IR inhibitors.
24266654 2014 Insulin-like growth factor 1 receptor and p38 mitogen-activated protein kinase signals inversely regulate signal transducer and activator of transcription 3 activity to control human dental pulp stem cell quiescence, propagation, and differentiation.
24250812 2013 MiR-223 regulates human embryonic stem cell differentiation by targeting the IGF-1R/Akt signaling pathway.
24227890 2014 Superior antitumor activity of a novel bispecific antibody cotargeting human epidermal growth factor receptor 2 and type I insulin-like growth factor receptor.
24222252 2013 Association of insulin growth factor-1 receptor gene polymorphisms with genetic susceptibility to idiopathic short stature.
24219294 2013 A combination of insulin and ubiquitin A20 promotes osteocalcin expression in adipose-derived stem cells.
24206174 2014 Epidermal growth factor receptor (EGFR), HER2 and insulin-like growth factor-1 receptor (IGF-1R) status in ovarian adult granulosa cell tumours.
24186206 2014 IGF-1R inhibition enhances radiosensitivity and delays double-strand break repair by both non-homologous end-joining and homologous recombination.
24135282 2013 DNp73 exerts function in metastasis initiation by disconnecting the inhibitory role of EPLIN on IGF1R-AKT/STAT3 signaling.
24130778 2013 IGF-IR promotes prostate cancer growth by stabilizing ?5?1 integrin protein levels.
24127040 2014 miR-133a suppresses ovarian cancer cell proliferation by directly targeting insulin-like growth factor 1 receptor.
24065146 2013 Drug synergy screen and network modeling in dedifferentiated liposarcoma identifies CDK4 and IGF1R as synergistic drug targets.
24055032 2013 Clinical significance of proliferation, apoptosis and senescence of nasopharyngeal cells by the simultaneously blocking EGF, IGF-1 receptors and Bcl-xl genes.
24039995 2013 miR-140 suppresses tumor growth and metastasis of non-small cell lung cancer by targeting insulin-like growth factor 1 receptor.
24039934 2013 Inhibition of type I insulin-like growth factor receptor signaling attenuates the development of breast cancer brain metastasis.
24026884 2014 The effect of IGF-I receptor blockade for human esophageal squamous cell carcinoma and adenocarcinoma.
24013232 2014 Fibulin-3-mediated inhibition of epithelial-to-mesenchymal transition and self-renewal of ALDH+ lung cancer stem cells through IGF1R signaling.
23994953 2013 IGF-1R/epithelial-to-mesenchymal transition (EMT) crosstalk suppresses the erlotinib-sensitizing effect of EGFR exon 19 deletion mutations.
23990442 2014 IGF-1R and Bmi-1 expressions in lung adenocarcinoma and their clinicopathologic and prognostic significance.
23989734 2013 Association of +3179G/A insulin-like growth factor-1 receptor polymorphism and insulin-like growth factor-1 serum level with systemic lupus erythematosus.
23983239 2013 Protein expression of PTEN, insulin-like growth factor I receptor (IGF-IR), and lethal prostate cancer: a prospective study.
23980150 2013 Insulin growth factor signaling is regulated by microRNA-486, an underexpressed microRNA in lung cancer.
23974362 2013 The miRNA let-7a1 inhibits the expression of insulin-like growth factor 1 receptor (IGF1R) in prostate cancer PC-3 cells.
23962053 2013 IGF-1 receptor and IGF binding protein-3 might predict prognosis of patients with resectable pancreatic cancer.
23928059 2013 Dynamic and nuclear expression of PDGFR? and IGF-1R in alveolar Rhabdomyosarcoma.
23899556 2013 Phosphorylation of P-Rex1 at serine 1169 participates in IGF-1R signaling in breast cancer cells.
23879873 2013 Genetic variants predicting left ventricular hypertrophy in a diabetic population: a Go-DARTS study including meta-analysis.
23873272 2013 Met, IGF1R, and other new targets in upper GI malignancies.
23867124 2013 Simultaneous targeting of insulin-like growth factor-1 receptor and anaplastic lymphoma kinase in embryonal and alveolar rhabdomyosarcoma: a rational choice.
23864387 2013 Insulin-like growth factor-I receptor is suppressed through transcriptional repression and mRNA destabilization by a novel energy restriction-mimetic agent.
23861540 2013 Receptor tyrosine kinases fall into distinct classes based on their inferred signaling networks.
23861377 2013 Deletion of growth hormone receptors in postnatal skeletal muscle of male mice does not alter muscle mass and response to pathological injury.
23857432 2013 Hospicells promote upregulation of the ATP-binding cassette genes by insulin-like growth factor-I via the JAK2/STAT3 signaling pathway in an ovarian cancer cell line.
23831640 2013 TGF-?-induced expression of IGFBP-3 regulates IGF1R signaling in human osteosarcoma cells.
23823800 2013 Effects of calorie restriction and IGF-1 receptor blockade on the progression of 22Rv1 prostate cancer xenografts.
23821363 2013 PDZK1 is a novel factor in breast cancer that is indirectly regulated by estrogen through IGF-1R and promotes estrogen-mediated growth.
23818948 2013 Potentiating the efficacy of molecular targeted therapy for hepatocellular carcinoma by inhibiting the insulin-like growth factor pathway.
23817810 2013 Phosphorylated insulin-like growth factor-1 receptor (pIGF1R) is a poor prognostic factor in brain metastases from lung adenocarcinomas.
23814047 2013 Protein-tyrosine phosphatase 1B antagonized signaling by insulin-like growth factor-1 receptor and kinase BRK/PTK6 in ovarian cancer cells.
23801064 2013 The role of insulin-like growth factor 1 and its receptor in the formation and development of colorectal carcinoma.
23797814 2013 Abnormal expression of insulin-like growth factor-I receptor in hepatoma tissue and its inhibition to promote apoptosis of tumor cells.
23792093 2013 IGF-1R and ErbB3/HER3 contribute to enhanced proliferation and carcinogenesis in trastuzumab-resistant ovarian cancer model.
23782942 2013 Growth hormone potentiates 17?-estradiol-dependent breast cancer cell proliferation independently of IGF-I receptor signaling.
23744486 2013 Analysis of expression of membrane-bound tumor markers in ductal carcinoma in situ of the breast: paving the way for molecular imaging.
23730215 2013 Molecular and functional characterizations of the association and interactions between nucleophosmin-anaplastic lymphoma kinase and type I insulin-like growth factor receptor.
23724116 2013 N-linked glycosylation supports cross-talk between receptor tyrosine kinases and androgen receptor.
23710710 2013 Heterogeneity of neuroblastoma cell lines in insulin-like growth factor 1 receptor/Akt pathway-mediated cell proliferative responses.
23704881 2013 Interaction between IGF-IR and ER induced by E2 and IGF-I.
23696648 2013 An integrin binding-defective mutant of insulin-like growth factor-1 (R36E/R37E IGF1) acts as a dominant-negative antagonist of the IGF1 receptor (IGF1R) and suppresses tumorigenesis but still binds to IGF1R.
23689439 2013 Expression of insulin-like growth factor 1 and insulin-like growth factor 1 receptor is associated with the favorable clinicopathologic parameters in small intestinal carcinomas.
23675407 2013 Upregulation of miR-150* and miR-630 induces apoptosis in pancreatic cancer cells by targeting IGF-1R.
23664098 2013 The strength of small: improved targeting of insulin-like growth factor-1 receptor (IGF-1R) with F(ab')?-R1507 fragments in Ewing sarcomas.
23663564 2013 The expression and significance of insulin-like growth factor-1 receptor and its pathway on breast cancer stem/progenitors.
23619944 2013 Insulin-like growth factor-1 receptor (IGF-1R) as a biomarker for resistance to the tyrosine kinase inhibitor gefitinib in non-small cell lung cancer.
23564324 2013 Downregulation of miR-383 promotes glioma cell invasion by targeting insulin-like growth factor 1 receptor.
23549953 2013 Involvement of IGF-1R regulation by miR-515-5p modifies breast cancer risk among BRCA1 carriers.
23548939 2013 Resistin decreases insulin-like growth factor I-induced steroid production and insulin-like growth factor I receptor signaling in human granulosa cells.
23539445 2013 ?-Catenin/POU5F1/SOX2 transcription factor complex mediates IGF-I receptor signaling and predicts poor prognosis in lung adenocarcinoma.
23531874 2013 A kinase-independent biological activity for insulin growth factor-1 receptor (IGF-1R) : implications for inhibition of the IGF-1R signal.
23527719 Evaluation of the expression and role of IGF pathway biomarkers in human sarcomas.
23526299 2013 Ligand-independent activation of MET through IGF-1/IGF-1R signaling.
23515613 2013 ERK phosphorylation is predictive of resistance to IGF-1R inhibition in small cell lung cancer.
23507142 2013 miR-16 inhibits cell proliferation by targeting IGF1R and the Raf1-MEK1/2-ERK1/2 pathway in osteosarcoma.
23506534 2013 Overexpression of the insulin-like growth factor 1 receptor (IGF-1R) is associated with malignancy in familial pheochromocytomas and paragangliomas.
23486542 2013 Intragenic deletions of the IGF1 receptor gene in five individuals with psychiatric phenotypes and developmental delay.
23460259 2013 GRK2 negatively regulates IGF-1R signaling pathway and cyclins' expression in HepG2 cells.
23453369 2013 MicroRNA-497 is a potential prognostic marker in human cervical cancer and functions as a tumor suppressor by targeting the insulin-like growth factor 1 receptor.
23431408 2013 MiRNA-181b suppresses IGF-1R and functions as a tumor suppressor gene in gliomas.
23418605 2013 Insulin-like growth factor receptor I (IGF-IR) and vascular endothelial growth factor receptor 2 (VEGFR-2) are expressed on the circulating epithelial tumor cells of breast cancer patients.
23416929 2013 Advanced glycation end products promote human aortic smooth muscle cell calcification in vitro via activating NF-?B and down-regulating IGF1R expression.
23404184 2013 Caveolin-1 and polymerase I and transcript release factor: new players in insulin-like growth factor-I receptor signaling.
23402816 2013 IGF1R-directed targeted therapy enhances the cytotoxic effect of chemotherapy in endometrial cancer.
23395167 2013 LRP6 enhances glucose metabolism by promoting TCF7L2-dependent insulin receptor expression and IGF receptor stabilization in humans.
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
23374155 2013 Evaluation of the coordinated actions of estrogen receptors with epidermal growth factor receptor and insulin-like growth factor receptor in the expression of cell surface heparan sulfate proteoglycans and cell motility in breast cancer cells.
23373509 2013 MicroRNA-100 regulates IGF1-receptor expression in metastatic pancreatic cancer cells.
23365645 2013 Insulin-like growth factor 1 receptor (IGF1R) expression and survival in operable squamous-cell laryngeal cancer.
23360921 2013 Survival is associated with genetic variation in inflammatory pathway genes among patients with resected and unresected pancreatic cancer.
23354097 2013 Phosphorylation of IGFBP-1 at discrete sites elicits variable effects on IGF-I receptor autophosphorylation.
23331867 2013 Vascular endothelial-cadherin stimulates syndecan-1-coupled insulin-like growth factor-1 receptor and cross-talk between ?V?3 integrin and vascular endothelial growth factor receptor 2 at the onset of endothelial cell dissemination during angiogenesis.
23314677 2013 Concomitant high gene copy number and protein overexpression of IGF1R and EGFR negatively affect disease-free survival of surgically resected non-small-cell-lung cancer patients.
23288662 2013 Expression and significance of IGF-1 and IGF-1R in thyroid nodules.
23266446 2013 Insulin-like growth factor-1 receptor protein expression and gene copy number alterations in non-small cell lung carcinomas.
23263486 2013 Genome-wide association analyses identify 18 new loci associated with serum urate concentrations.
23252569 2013 Expression of IGF-1 receptor in KIT/PDGF receptor-? wild-type gastrointestinal stromal tumors with succinate dehydrogenase complex dysfunction.
23250396 2012 IGFBP7 binds to the IGF-1 receptor and blocks its activation by insulin-like growth factors.
23239200 2013 Selective tyrosine kinase inhibition of insulin-like growth factor-1 receptor inhibits human and mouse breast cancer-induced bone cell activity, bone remodeling, and osteolysis.
23190452 2013 Regulation of insulin and type 1 insulin-like growth factor signaling and action by the Grb10/14 and SH2B1/B2 adaptor proteins.
23152410 2012 IGF-I receptor phosphorylation is impaired in cathepsin X-deficient prostate cancer cells.
23118311 2013 Local control of nuclear calcium signaling in cardiac myocytes by perinuclear microdomains of sarcolemmal insulin-like growth factor 1 receptors.
23109135 2013 Overexpression of insulin-like growth factor 1 receptor and frequent mutational inactivation of SDHA in wild-type SDHB-negative gastrointestinal stromal tumors.
23106397 2013 Activation of the insulin-like growth factor-1 receptor alters p27 regulation by the epidermal growth factor receptor in oral squamous carcinoma cells.
23082760 2013 Transfer of growth factor receptor mRNA via exosomes unravels the regenerative effect of mesenchymal stem cells.
23056576 2012 MiR-122 inhibits cell proliferation and tumorigenesis of breast cancer by targeting IGF1R.
22998174 2013 Analysis of the insulin-like growth factor 1 receptor gene in children born small for gestational age: in vitro characterization of a novel mutation (p.Arg511Trp).
22972910 2012 IGF receptor gene variants in normal adolescents: effect on stature.
22935141 2013 A regulatory circuit of miR-148a/152 and DNMT1 in modulating cell transformation and tumor angiogenesis through IGF-IR and IRS1.
22932330 2012 [Clinicopathological significance of expression of IGF-1R in uveal melanoma and its association with expression of p-AKT Thr308].
22931894 2012 MVP expression in the prediction of clinical outcome of locally advanced oral squamous cell carcinoma patients treated with radiotherapy.
22909219 2012 Polymorphism of IGF1R is associated with papillary thyroid carcinoma in a Korean population.
22894899 2012 Disruption of the protein interaction between FAK and IGF-1R inhibits melanoma tumor growth.
22892600 2013 Expression of the receptor for type i insulin-like growth factor (IGF1R) in gastrointestinal stromal tumors: an immunohistochemical study of 1078 cases with diagnostic and therapeutic implications.
22879999 2012 Novel nuclear localization and potential function of insulin-like growth factor-1 receptor/insulin receptor hybrid in corneal epithelial cells.
22875931 2012 Upregulation of the E3 ligase NEDD4-1 by oxidative stress degrades IGF-1 receptor protein in neurodegeneration.
22825921 2012 Insulin and IGF1 receptors in human cardiac microvascular endothelial cells: metabolic, mitogenic and anti-inflammatory effects.
22777769 2012 VEGF/neuropilin-2 regulation of Bmi-1 and consequent repression of IGF-IR define a novel mechanism of aggressive prostate cancer.
22767591 2012 Phosphatidylinositol 3-kinase (PI3K) activity bound to insulin-like growth factor-I (IGF-I) receptor, which is continuously sustained by IGF-I stimulation, is required for IGF-I-induced cell proliferation.
22738321 2013 Familial short stature and intrauterine growth retardation associated with a novel mutation in the IGF-I receptor (IGF1R) gene.
22710713 2013 MicroRNA-497 targets insulin-like growth factor 1 receptor and has a tumour suppressive role in human colorectal cancer.
22700994 2012 Protein expression and gene copy number changes of receptor tyrosine kinase in thymomas and thymic carcinomas.
22685298 2012 Serine phosphorylation of the insulin-like growth factor I (IGF-1) receptor C-terminal tail restrains kinase activity and cell growth.
22682017 2012 Insulin-like growth factor type 1 receptor (IGF-1R) exclusive nuclear staining: a predictive biomarker for IGF-1R monoclonal antibody (Ab) therapy in sarcomas.
22635104 2012 Involvement of insulin-like growth factor 1 receptor signaling in the amyloid-? peptide oligomers-induced p75 neurotrophin receptor protein expression in mouse hippocampus.
22626974 2012 Tissue distribution and cancer growth inhibition of magnetic lipoplex-delivered type 1 insulin-like growth factor receptor shRNA in nude mice.
22623732 2012 Serum insulin-like growth factor-1 levels predict outcomes of patients with advanced hepatocellular carcinoma receiving antiangiogenic therapy.
22614005 2013 MicroRNA-7 functions as an anti-metastatic microRNA in gastric cancer by targeting insulin-like growth factor-1 receptor.
22572840 2012 IGF1, IGF1R and SHOX mutation analysis in short children born small for gestational age and short children with normal birth size (idiopathic short stature).
22555179 2012 Succinate dehydrogenase-deficient GISTs are characterized by IGF1R overexpression.
22541124 2012 [Effects of insulin on expression of insulin receptor and insulin-like growth factor-1 receptor and proliferation in Reh cells].
22509025 2012 Selective recruitment of G protein-coupled receptor kinases (GRKs) controls signaling of the insulin-like growth factor 1 receptor.
22508822 2012 Phase II study of ganitumab, a fully human anti-type-1 insulin-like growth factor receptor antibody, in patients with metastatic Ewing family tumors or desmoplastic small round cell tumors.
22506015 2012 Nuclear targeting of IGF-1 receptor in orbital fibroblasts from Graves' disease: apparent role of ADAM17.
22495974 2012 Global methylation analysis identifies PITX2 as an upstream regulator of the androgen receptor and IGF-I receptor genes in prostate cancer.
22438913 2012 Heterodimerization of glycosylated insulin-like growth factor-1 receptors and insulin receptors in cancer cells sensitive to anti-IGF1R antibody.
22424712 2012 Notch-mediated repression of miR-223 contributes to IGF1R regulation in T-ALL.
22419550 2012 TROP2 is epigenetically inactivated and modulates IGF-1R signalling in lung adenocarcinoma.
22406993 2012 Antitumor effects of novel shorter truncated insulin-like growth factor I receptors.
22394253 2012 An activity-based probe reveals dynamic protein-protein interactions mediating IGF-1R transactivation by the GABA(B) receptor.
22372631 2012 Does insulin-like growth factor 1 receptor (IGF-1R) targeting provide new treatment options for chordomas? A retrospective clinical and immunohistochemical study.
22354554 2012 Genome-wide association analysis of juvenile idiopathic arthritis identifies a new susceptibility locus at chromosomal region 3q13.
22351760 2012 Cross-talk between integrin ?6?4 and insulin-like growth factor-1 receptor (IGF1R) through direct ?6?4 binding to IGF1 and subsequent ?6?4-IGF1-IGF1R ternary complex formation in anchorage-independent conditions.
22348393 2012 Targeting the IGF-1R signaling and mechanisms for epigenetic gene silencing in human multiple myeloma.
22343486 2012 c-Met, epidermal growth factor receptor, and insulin-like growth factor-1 receptor are important for growth in uveal melanoma and independently contribute to migration and metastatic potential.
22339909 2011 [The type I insulin-like growth factor receptor highly expressed in clonal cells of myelodysplastic syndromes].
22336232 2012 [Relationship of insulin-like growth factor receptor single nucleotide polymorphism (SNP) with platinum-based chemotherapy outcomes in advanced non-small cell lung cancer].
22335030 2011 Expression of IGF-1R, VEGF-C and D2-40 and their correlation with lymph node metastasis in endometrial adenocarcinoma.
22325222 2011 [Expression of IGF-1R in esophageal squamous cell carcinoma and the effect of its silencing by siRNA on the proliferation of esophageal cancer EC9706 cells in vitro].
22309212 2012 Novel missense mutation in the IGF-I receptor L2 domain results in intrauterine and postnatal growth retardation.
22303694 2011 [The expression and significance of IGF-1R in nasal polyp and its relationship with allergic rhinitis].
22285568 2012 Expressions of insulin-like growth factor receptor-1 and insulin-like growth factor binding protein 3 in advanced non-small-cell lung cancer.
22275271 2012 Inhibition of IGF-IR increases chemosensitivity in human colorectal cancer cells through MRP-2 promoter suppression.
22261717 2012 Nuclear IGF1R is a transcriptional co-activator of LEF1/TCF.
22246875 2012 Impaired expression of insulin-like growth factor-1 system in skeletal muscle of amyotrophic lateral sclerosis patients.
22245152 2012 Hypoxia-induced SM22? in A549 cells activates the IGF1R/PI3K/Akt pathway, conferring cellular resistance against chemo- and radiation therapy.
22235273 2012 Small interfering RNA targeted to IGF-IR delays tumor growth and induces proinflammatory cytokines in a mouse breast cancer model.
22218435 2011 [Mutations in insulin-like growth factor receptor 1 gene (IGF1R) resulting in intrauterine and postnatal growth retardation].
22194466 2012 Metastatic cells can escape the proapoptotic effects of TNF-? through increased autocrine IL-6/STAT3 signaling.
22188815 2012 Potent inhibition of angiogenesis by the IGF-1 receptor-targeting antibody SCH717454 is reversed by IGF-2.
22179513 2012 The inhibitory effects of NKX3.1 on IGF-1R expression and its signalling pathway in human prostatic carcinoma PC3 cells.
22172258 2011 [Association between single nucleotide polymorphism of insulin-like growth factor receptor gene and idiopathic short stature].
22161861 2012 Epithelial-mesenchymal transition predicts sensitivity to the dual IGF-1R/IR inhibitor OSI-906 in hepatocellular carcinoma cell lines.
22146489 2012 IGF-1 and its receptor in esophageal cancer: association with adenocarcinoma and visceral obesity.
22140443 2011 Understanding the mechanism of insulin and insulin-like growth factor (IGF) receptor activation by IGF-II.
22133293 2012 Clinical significance of IGF1R expression in non-small-cell lung cancer.
22130793 2012 Severe short stature caused by novel compound heterozygous mutations of the insulin-like growth factor 1 receptor (IGF1R).
22128190 2012 Insulin-like growth factor-I receptor (IGF-IR) translocates to nucleus and autoregulates IGF-IR gene expression in breast cancer cells.
22120672 2012 Ovarian cancer: Stat3, RhoA and IGF-IR as therapeutic targets.
22115966 2012 Induction of IGF-1R expression by EGR-1 facilitates the growth of prostate cancer cells.
22115178 2011 Insulin-like growth factor 1 receptor polymorphism rs2229765 and circulating interleukin-6 level affect male longevity in a population-based prospective study (Treviso Longeva--TRELONG).
22058336 2011 Associations between genetic polymorphisms of insulin-like growth factor axis genes and risk for age-related macular degeneration.
22044563 2012 Insulin-like growth factor receptor expression is associated with aggressive phenotypes and has therapeutic activity in biliary tract cancers.
22042973 2011 Genomic and molecular characterization of malignant peripheral nerve sheath tumor identifies the IGF1R pathway as a primary target for treatment.
22033326 2012 p53 Regulates insulin-like growth factor-I receptor gene expression in uterine serous carcinoma and predicts responsiveness to an insulin-like growth factor-I receptor-directed targeted therapy.
22020329 2012 Transgenic IGF-IR overexpression induces mammary tumors with basal-like characteristics, whereas IGF-IR-independent mammary tumors express a claudin-low gene signature.
22020193 2012 Involvement of the PI3K/Akt pathway in myxoid/round cell liposarcoma.
21994939 2011 Polyubiquitination of insulin-like growth factor I receptor (IGF-IR) activation loop promotes antibody-induced receptor internalization and down-regulation.
21972777 2011 Molecular mechanisms underlying insulin-like growth factor action: How mutations in the GH: IGF axis lead to short stature.
21959795 2012 Gefitinib resistance in HCC mahlavu cells: upregulation of CD133 expression, activation of IGF-1R signaling pathway, and enhancement of IGF-1R nuclear translocation.
21958043 2011 Zyflamend reduces the expression of androgen receptor in a model of castrate-resistant prostate cancer.
21943825 2011 Inactivation of Rac1 reduces Trastuzumab resistance in PTEN deficient and insulin-like growth factor I receptor overexpressing human breast cancer SKBR3 cells.
21939528 2011 erbB3 recruitment of insulin receptor substrate 1 modulates insulin-like growth factor receptor signalling in oestrogen receptor-positive breast cancer cell lines.
21931726 2011 The mechanism of action of the histone deacetylase inhibitor vorinostat involves interaction with the insulin-like growth factor signaling pathway.
21908557 2011 A kinome-wide screen identifies the insulin/IGF-I receptor pathway as a mechanism of escape from hormone dependence in breast cancer.
21873172 2011 Expression of IGF-1 and IGF-1R and their relation to clinicopathological factors in colorectal cancer.
21866554 2012 Increased expression of insulin-like growth factor-1 receptor is correlated with tumor metastasis and prognosis in patients with osteosarcoma.
21862872 2011 Potent anti-proliferative effects of metformin on trastuzumab-resistant breast cancer cells via inhibition of erbB2/IGF-1 receptor interactions.
21852217 2012 Insulin-like growth factor axis gene polymorphisms modify risk of pancreatic cancer.
21845403 2012 Age and estrogen-based hormone therapy affect systemic and local IL-6 and IGF-1 pathways in women.
21840990 2011 Decorin antagonizes IGF receptor I (IGF-IR) function by interfering with IGF-IR activity and attenuating downstream signaling.
21811077 2011 An insulin-like growth factor-I receptor defect associated with short stature and impaired carbohydrate homeostasis in an Italian pedigree.
21807868 2011 High-level IGF1R expression is required for leukemia-initiating cell activity in T-ALL and is supported by Notch signaling.
21799000 2011 IGF-I stimulates cooperative interaction between the IGF-I receptor and CSK homologous kinase that regulates SHPS-1 phosphorylation in vascular smooth muscle cells.
21748295 2011 Insulin-like growth factor-1 receptor gene expression is associated with survival in breast cancer: a comprehensive analysis of gene copy number, mRNA and protein expression.
21732141 2012 Expression of IGF1R is associated with tumor differentiation and survival in patients with lung adenocarcinoma.
21729677 2011 Is there a role for IGF1R and c-MET pathways in resistance to cetuximab in metastatic colorectal cancer?
21728395 2011 Expression of IGF-1R in colorectal polyps and its role in colorectal carcinogenesis.
21713359 [Insulin-like growth factor receptor I signaling in a breast cancer cell line].
21687694 2011 MiRNA expression in psoriatic skin: reciprocal regulation of hsa-miR-99a and IGF-1R.
21685939 2012 Identification of the cathelicidin peptide LL-37 as agonist for the type I insulin-like growth factor receptor.
21677874 2011 Insulin-like growth factor-dependent proliferation and survival of triple-negative breast cancer cells: implications for therapy.
21677036 2011 Autoimmunity in Graves' ophthalmopathy: the result of an unfortunate marriage between TSH receptors and IGF-1 receptors?
21654344 2011 Comprehensive analysis of receptor tyrosine kinase activation in human melanomas reveals autocrine signaling through IGF-1R.
21645859 2011 Fine details of IGF-1R activation, inhibition, and asymmetry determined by associated hydrogen /deuterium-exchange and peptide mass mapping.
21620944 Computational model of EGFR and IGF1R pathways in lung cancer: a Systems Biology approach for Translational Oncology.
21611203 2011 IGF1R signaling in Ewing sarcoma is shaped by clathrin-/caveolin-dependent endocytosis.
21595894 2011 Elevated insulin-like growth factor 1 receptor signaling induces antiestrogen resistance through the MAPK/ERK and PI3K/Akt signaling routes.
21574055 2012 Insulin-like growth factor receptor (IGF-1R) in breast cancer subtypes.
21546606 2011 Insulin-like growth factor-1 receptor identifies a pool of human cardiac stem cells with superior therapeutic potential for myocardial regeneration.
21538027 2011 Inhibition of IGF-1R-dependent PI3K activation sensitizes colon cancer cells specifically to DR5-mediated apoptosis but not to rhTRAIL.
21524684 2011 Differential effects of IGF-I, IGF-II and insulin in human preadipocytes and adipocytes--role of insulin and IGF-I receptors.
21471532 Expression of the insulin-like growth factor 1 (IGF-1) and type I IGF receptor mRNAs in human HLE-B3 lens epithelial cells.
21450456 2011 Insulin-like growth factor-I receptor (IGF-IR) targeting with monoclonal antibody cixutumumab (IMC-A12) inhibits IGF-I action in endometrial cancer cells.
21447712 2011 Evasion mechanisms to Igf1r inhibition in rhabdomyosarcoma.
21447702 2011 Calcium and osteoprotegerin regulate IGF1R expression to inhibit vascular calcification.
21442237 2011 Down-regulation of IGF-1R expression inhibits growth and enhances chemosensitivity of endometrial carcinoma in vitro.
21441024 2011 Discovery of the first non-ATP competitive IGF-1R kinase inhibitors: advantages in comparison with competitive inhibitors.
21414779 2011 Discovery of 2,4-bis-arylamino-1,3-pyrimidines as insulin-like growth factor-1 receptor (IGF-1R) inhibitors.
21410323 2011 Insulin-like growth factor-2 (IGF-2) activates estrogen receptor-? and -? via the IGF-1 and the insulin receptors in breast cancer cells.
21402719 2011 A steric blocker of translation elongation inhibits IGF-1R expression and cell transformation.
21396585 2011 IGF1R mutations as cause of SGA.
21393993 A stable IgG-like bispecific antibody targeting the epidermal growth factor receptor and the type I insulin-like growth factor receptor demonstrates superior anti-tumor activity.
21388493 2011 Impaired IGF1R signaling in cells expressing longevity-associated human IGF1R alleles.
21372220 2011 Heat shock protein 90-sheltered overexpression of insulin-like growth factor 1 receptor contributes to malignancy of thymic epithelial tumors.
21340542 2012 A/ASP/VAL allele combination of IGF1R, IRS2, and UCP2 genes is associated with better metabolic profile, preserved energy expenditure parameters, and low mortality rate in longevity.
21338601 2011 Anti-tumor effect in human breast cancer by TAE226, a dual inhibitor for FAK and IGF-IR in vitro and in vivo.
21330319 2011 Expression and effects of inhibition of type I insulin-like growth factor receptor tyrosine kinase in mantle cell lymphoma.
21317933 2011 P-cadherin cooperates with insulin-like growth factor-1 receptor to promote metastatic signaling of gonadotropin-releasing hormone in ovarian cancer via p120 catenin.
21304894 2011 Mapping a new spontaneous preterm birth susceptibility gene, IGF1R, using linkage, haplotype sharing, and association analysis.
21292299 2011 Insulin-like growth factor I receptor ? expression in hepatocellular carcinoma.
21273178 2011 A role for IGF-1R-targeted therapies in small-cell lung cancer?
21258401 2011 IL-6 promotes prostate tumorigenesis and progression through autocrine cross-activation of IGF-IR.
21251749 2011 Association between endometriosis and polymorphisms in insulin-like growth factors (IGFs) and IGF-I receptor genes in Korean women.
21217522 2011 Insulin-like growth factor receptor-1 (IGF-1R) expression in normal breast, proliferative breast lesions, and breast carcinoma.
21212273 2011 Insulin-like growth factor-1 receptor transactivation modulates the inflammatory and proliferative responses of neurotensin in human colonic epithelial cells.
21204214 2011 IGF1R variants associated with isolated single suture craniosynostosis.
21197570 2011 Expression of IGF1R in normal breast tissue and subsequent risk of breast cancer.
21177763 2011 High IGF-IR activity in triple-negative breast cancer cell lines and tumorgrafts correlates with sensitivity to anti-IGF-IR therapy.
21159245 2010 [Correlations between IGF-IR expression and clinicopathological factors and prognosis in patients with lung adenocarcinoma].
21152401 2010 IGF-IR internalizes with Caveolin-1 and PTRF/Cavin in HaCat cells.
21147068 2011 Over-accumulation of nuclear IGF-1 receptor in tumor cells requires elevated expression of the receptor and the SUMO-conjugating enzyme Ubc9.
21139137 2010 Dependence receptors: the trophic theory revisited.
21124078 2010 Increased insulin-like growth factor 1 receptor protein expression and gene copy number in small cell lung cancer.
21123183 2011 Stable IgG-like bispecific antibodies directed toward the type I insulin-like growth factor receptor demonstrate enhanced ligand blockade and anti-tumor activity.
21122407 2010 [Relationship between the insulin-like growth factor 1 receptor signaling pathway and the resistance of nasopharyngeal carcinoma to cetuximab].
21075859 2010 Dopamine, by acting through its D2 receptor, inhibits insulin-like growth factor-I (IGF-I)-induced gastric cancer cell proliferation via up-regulation of Krüppel-like factor 4 through down-regulation of IGF-IR and AKT phosphorylation.
21057462 2011 Increased insulin-like growth factor-1 receptor mRNA expression predicts poor survival in immunophenotypes of early breast carcinoma.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
21047277 2011 Polymorphisms of insulin-like growth factor-1 (IGF-1) and IGF-1 receptor (IGF-1R) contribute to pathologic progression in childhood IgA nephropathy.
21046444 2010 Are elevated levels of IGF-1 caused by coronary arteriesoclerosis?: Molecular and clinical analysis.
21041409 2010 Delta40p53 controls the switch from pluripotency to differentiation by regulating IGF signaling in ESCs.
20976540 2011 Ras-related protein 1 and the insulin-like growth factor type I receptor are associated with risk of progression in patients diagnosed with carcinoma in situ.
20962017 2011 Clinical and functional characteristics of a novel heterozygous mutation of the IGF1R gene and IGF1R haploinsufficiency due to terminal 15q26.2->qter deletion in patients with intrauterine growth retardation and postnatal catch-up growth failure.
20950153 2010 Inhibitory effect of small interfering RNA targeting insulin-like growth factor-I receptor in ovarian cancer OVCAR3 cells.
20940305 2010 The anti-angiogenic peptide, loop 6, binds insulin-like growth factor-1 receptor.
20935157 2010 Germline polymorphisms in genes involved in the IGF1 pathway predict efficacy of cetuximab in wild-type KRAS mCRC patients.
20927124 2011 Propionibacterium acnes activates the IGF-1/IGF-1R system in the epidermis and induces keratinocyte proliferation.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20871634 2011 Regulation of receptor for activated C kinase 1 protein by the von Hippel-Lindau tumor suppressor in IGF-I-induced renal carcinoma cell invasiveness.
20847162 2010 ImmunoSPECT and immunoPET of IGF-1R expression with the radiolabeled antibody R1507 in a triple-negative breast cancer model.
20837466 2010 Golgi calcium pump secretory pathway calcium ATPase 1 (SPCA1) is a key regulator of insulin-like growth factor receptor (IGF1R) processing in the basal-like breast cancer cell line MDA-MB-231.
20819078 2010 MicroRNA-7 targets IGF1R (insulin-like growth factor 1 receptor) in tongue squamous cell carcinoma cells.
20818434 2010 Insulin-like growth factor 1 receptor antibody induces rhabdomyosarcoma cell death via a process involving AKT and Bcl-x(L).
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20736806 2010 Insulin-like growth factor-1 receptor expression in thymic malignancies.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20731749 2011 Cross-talk between angiotensin II and IGF-1-induced connexin 43 expression in human saphenous vein smooth muscle cells.
20713879 2010 Randomized, phase II study of the insulin-like growth factor-1 receptor inhibitor IMC-A12, with or without cetuximab, in patients with cetuximab- or panitumumab-refractory metastatic colorectal cancer.
20675137 2010 Proline isosteres in a series of 2,4-disubstituted pyrrolo[1,2-f][1,2,4]triazine inhibitors of IGF-1R kinase and IR kinase.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20670935 2010 The reciprocal regulation of gamma-synuclein and IGF-I receptor expression creates a circuit that modulates IGF-I signaling.
20648549 2011 Growth factor signaling pathways as targets for prevention of epithelial carcinogenesis.
20644561 2011 A large-scale candidate gene approach identifies SNPs in SOD2 and IL13 as predictive markers of response to preoperative chemoradiation in rectal cancer.
20634197 2010 Comprehensive analysis of common genetic variation in 61 genes related to steroid hormone and insulin-like growth factor-I metabolism and breast cancer risk in the NCI breast and prostate cancer cohort consortium.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20620597 2010 The expression and role of hybrid insulin/insulin-like growth factor receptor type 1 in endometrial carcinoma cells.
20596523 2010 Development and validation of a method for profiling post-translational modification activities using protein microarrays.
20592355 2010 Insulin-like growth factor-1 receptor (IGF-1R) in primary and metastatic undifferentiated carcinoma of the head and neck: a possible target of immunotherapy.
20587610 2010 Examination of genetic polymorphisms in newborns for signatures of sex-specific prenatal selection.
20580999 2010 Body size, IGF and growth hormone polymorphisms, and colorectal adenomas and hyperplastic polyps.
20569071 2010 Overexpression of IGF-IR in malignant clonal cells in bone marrow of myelodysplastic syndromes.
20545947 2010 Design of potent IGF1-R inhibitors related to bis-azaindoles.
20504360 2010 Resveratrol suppresses IGF-1 induced human colon cancer cell proliferation and elevates apoptosis via suppression of IGF-1R/Wnt and activation of p53 signaling pathways.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20432247 2010 The human IGF1R IRES likely operates through a Shine-Dalgarno-like interaction with the G961 loop (E-site) of the 18S rRNA and is kinetically modulated by a naturally polymorphic polyU loop.
20422977 2010 [Expression and significance of IGF-IR and PKC in laryngeal squamous cell carcinoma].
20417685 2010 Differential regulation of insulin-like growth factor-I receptor gene expression by wild type and mutant androgen receptor in prostate cancer cells.
20417200 2010 Disruption of IGF-1R signaling increases TRAIL-induced apoptosis: a new potential therapy for the treatment of melanoma.
20416304 2010 Insulin-like growth factor axis gene polymorphisms and clinical outcomes in pancreatic cancer.
20403354 2010 A population-based study of IGF axis polymorphisms and the esophageal inflammation, metaplasia, adenocarcinoma sequence.
20397262 2010 Insulin-like growth factor-I receptor in proliferation and motility of pancreatic cancer.
20395438 2010 The insulin-like growth factor receptor I promotes motility and invasion of bladder cancer cells through Akt- and mitogen-activated protein kinase-dependent activation of paxillin.
20389101 2010 Expression and protein content of IGF-I and IGF-I receptor in placentas from small, adequate and large for gestational age newborns.
20360006 2010 Insulin and insulin-like growth factor-1 receptors act as ligand-specific amplitude modulators of a common pathway regulating gene transcription.
20357178 2010 A heterozygous mutation of the insulin-like growth factor-I receptor causes retention of the nascent protein in the endoplasmic reticulum and results in intrauterine and postnatal growth retardation.
20351332 2010 Insulin-like growth factor receptor 1 (IGF1R) gene copy number is associated with survival in operable non-small-cell lung cancer: a comparison between IGF1R fluorescent in situ hybridization, protein expression, and mRNA expression.
20347606 2010 Insulin-like growth factors I and II receptors in the breast cancer survival disparity among African-American women.
20302654 2010 Genotypes and haplotypes in the insulin-like growth factors, their receptors and binding proteins in relation to plasma metabolic levels and mammographic density.
20233590 2010 Northwestern profiling of potential translation-regulatory proteins in human breast epithelial cells and malignant breast tissues: evidence for pathological activation of the IGF1R IRES.
20204283 2010 Prognostic significance of insulin growth factor-I receptor and insulin growth factor binding protein-3 expression in primary breast cancer.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
20200332 2010 Family-based analysis of candidate genes for polycystic ovary syndrome.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
20193554 2009 [Association between insulin-like growth factor-1 receptor gene polymorphisms and with susceptibility to adolescent idiopathic scoliosis].
20179633 2010 Role of genetic variation in insulin-like growth factor 1 receptor on insulin resistance and arterial hypertension.
20178321 2010 Discovery and SAR of thiazolidine-2,4-dione analogues as insulin-like growth factor-1 receptor (IGF-1R) inhibitors via hierarchical virtual screening.
20154720 2010 Notch-1 stimulates survival of lung adenocarcinoma cells during hypoxia by activating the IGF-1R pathway.
20145208 2010 SUMOylation mediates the nuclear translocation and signaling of the IGF-1 receptor.
20131294 2010 SirT1 enhances survival of human osteoarthritic chondrocytes by repressing protein tyrosine phosphatase 1B and activating the insulin-like growth factor receptor pathway.
20119675 2010 Relationship of insulin-like growth factors system gene polymorphisms with the susceptibility and pathological development of hepatocellular carcinoma.
20104520 2010 Insulin-like growth factor-1 receptor as a novel prognostic marker and its implication as a cotarget in the treatment of human adenocarcinoma of the esophagus.
20103837 2009 Mechanisms of antibody-mediated insulin-like growth factor I receptor (IGF-IR) down-regulation in MCF-7 breast cancer cells.
20103656 2010 Heterozygous mutation within a kinase-conserved motif of the insulin-like growth factor I receptor causes intrauterine and postnatal growth retardation.
20103628 2010 Heterotrimerization of the growth factor receptors erbB2, erbB3, and insulin-like growth factor-i receptor in breast cancer cells resistant to herceptin.
20080972 2010 Prolactin enhances insulin-like growth factor I receptor phosphorylation by decreasing its association with the tyrosine phosphatase SHP-2 in MCF-7 breast cancer cells.
20078550 2009 Prognostic role of insulin-like growth factor receptor-1 expression in small cell lung cancer.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20061986 2010 Correlation of clinicopathological parameters with HGF, c-Met, EGFR, and IGF-1R expression in uveal melanoma.
20061696 2010 Prognostic value of insulin- like growth factor-I receptor expression in renal cell carcinoma.
20009360 2010 Tumor necrosis factor-alpha (TNF-alpha) inhibits insulin-like growth factor-I (IGF-I) activities in human trophoblast cell cultures through IGF-I/insulin hybrid receptors.
19996272 2009 BMS-754807, a small molecule inhibitor of insulin-like growth factor-1R/IR.
19966862 2010 The IGF-1/IGF-1R signaling axis in the skin: a new role for the dermis in aging-associated skin cancer.
19950226 2010 Single nucleotide polymorphisms in miRNA binding sites and miRNA genes as breast/ovarian cancer risk modifiers in Jewish high-risk women.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19877134 2009 Sequence variation in IGF1R is associated with differences in insulin levels in nondiabetic Old Order Amish.
19874825 2009 Pancreatic cancer cells activate CCL5 expression in mesenchymal stromal cells through the insulin-like growth factor-I pathway.
19855090 2009 The IGF-I receptor can alter the matrix metalloproteinase repertoire of tumor cells through transcriptional regulation of PKC-{alpha}.
19853071 2010 Insulin-like growth factor-1 is associated with bone formation markers, PTH and bone mineral density in healthy premenopausal women.
19843326 2009 Genetic variation in insulin-like growth factor signaling genes and breast cancer risk among BRCA1 and BRCA2 carriers.
19838209 2010 The type I insulin-like growth factor receptor regulates cancer metastasis independently of primary tumor growth by promoting invasion and survival.
19835884 2009 Solution structure of ectodomains of the insulin receptor family: the ectodomain of the type 1 insulin-like growth factor receptor displays asymmetry of ligand binding accompanied by limited conformational change.
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
19817984 2009 Insulin/IGF-1 hybrid receptor expression on human platelets: consequences for the effect of insulin on platelet function.
19812598 2010 Somatic mutation of epidermal growth factor receptor in a small subset of cutaneous squamous cell carcinoma.
19806209 2009 High expression levels of total IGF-1R and sensitivity of NSCLC cells in vitro to an anti-IGF-1R antibody (R1507).
19778024 2009 Discovery of a 2,4-disubstituted pyrrolo[1,2-f][1,2,4]triazine inhibitor (BMS-754807) of insulin-like growth factor receptor (IGF-1R) kinase in clinical development.
19767315 2010 Insulin-like growth factor receptor 1 (IGF1R) expression and survival in surgically resected non-small-cell lung cancer (NSCLC) patients.
19759555 2010 Association of insulin-like growth factor-1 receptor gene polymorphisms with left ventricular mass and geometry in essential hypertension.
19749460 High frequency of loss of allelic integrity at Wilms' tumor suppressor gene-1 locus in advanced breast tumors associated with aggressiveness of the tumor.
19713175 2009 Levels of insulin-like growth factors and their receptors in placenta in relation to macrosomia.
19703789 2010 Transcription factor E2F1 is a potent transactivator of the insulin-like growth factor-I receptor (IGF-IR) gene.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19680556 2009 Genetic variation in healthy oldest-old.
19679045 2009 A polymorphic variant of the insulin-like growth factor type I receptor gene modifies risk of obesity for esophageal adenocarcinoma.
19672856 2009 Insulin-like growth factor 1 receptor expression in wild-type GISTs: a potential novel therapeutic target.
19669768 2010 Downregulation of IGF-IR expression by RNAi inhibits proliferation and enhances chemosensitization of human colon cancer cells.
19664602 2009 Targeting of the protein interaction site between FAK and IGF-1R.
19658040 2010 Mutation analysis of the growth factor genes PlGF, Flt1, IGF-I, and IGF-IR in intrauterine growth restriction with abnormal placental blood flow.
19657367 2009 Genetic polymorphisms of EPHX1, Gsk3beta, TNFSF8 and myeloma cell DKK-1 expression linked to bone disease in myeloma.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19584075 2009 Novel susceptibility loci for second primary tumors/recurrence in head and neck cancer patients: large-scale evaluation of genetic variants.
19582762 2009 Insulin-like growth factor type I receptor gene expression and obesity in esophageal adenocarcinoma.
19578119 2009 The direct binding of insulin-like growth factor-1 (IGF-1) to integrin alphavbeta3 is involved in IGF-1 signaling.
19545541 2009 Focal adhesion kinase (FAK) activates and stabilizes IGF-1 receptor.
19524379 2009 Influence of insulin resistance on adiponectin receptor expression in breast cancer.
19509240 2009 Validation of the type 1 insulin-like growth factor receptor as a therapeutic target in renal cancer.
19500509 2009 [Expression and significance of IGF-1R and VEGF in gastric carcinoma].
19488994 2009 Aged human thymus hassall's corpuscles are immunoreactive for IGF-I and IGF-I receptor.
19473988 2009 Increased intraocular insulin-like growth factor-I triggers blood-retinal barrier breakdown.
19460140 2009 A polymorphic variant of the insulin-like growth factor 1 (IGF-1) receptor correlates with male longevity in the Italian population: a genetic study and evaluation of circulating IGF-1 from the "Treviso Longeva (TRELONG)" study.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19423729 2009 IGF-IR tyrosine kinase interacts with NPM-ALK oncogene to induce survival of T-cell ALK+ anaplastic large-cell lymphoma cells.
19406106 2009 Insulin-like growth factor-1 receptor activation prevents high glucose-induced mitochondrial dysfunction, cytochrome-c release and apoptosis.
19391107 2009 Mechanism of growth inhibition by MicroRNA 145: the role of the IGF-I receptor signaling pathway.
19381485 2008 Expression of IGF-1R and iNOS in nasal polyps; epithelial cell homeostasis and innate immune mechanisms in pathogenesis of nasal polyposis.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19351509 2009 [Expression of IGF-IR and COX-2 in renal cell carcinoma and their relationship with cell proliferation].
19330903 2009 Gene by smoking interaction in hypertension: identification of a major quantitative trait locus on chromosome 15q for systolic blood pressure in Mexican-Americans.
19318572 2009 Hyperactivation of the insulin-like growth factor receptor I signaling pathway is an essential event for cisplatin resistance of ovarian cancer cells.
19241236 2009 Expression of the insulin-like growth factor receptor 1 during human embryogenesis.
19240157 2009 Divergent frequencies of IGF-I receptor-expressing blood lymphocytes in monozygotic twin pairs discordant for Graves' disease: evidence for a phenotypic signature ascribable to nongenetic factors.
19190347 2009 Insulin receptor substrate-2 mediated insulin-like growth factor-I receptor overexpression in pancreatic adenocarcinoma through protein kinase Cdelta.
19176870 2009 Phosphorylated insulin like growth factor-I receptor expression and its clinico-pathological significance in histologic subtypes of human thyroid cancer.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19160858 2008 [Expression and clinical significance of insulin like growth factor-1 protein in nasopharyngeal carcinoma].
19153117 2009 High coexpression of both insulin-like growth factor receptor-1 (IGFR-1) and epidermal growth factor receptor (EGFR) is associated with shorter disease-free survival in resected non-small-cell lung cancer patients.
19139090 2009 A novel approach to identify two distinct receptor binding surfaces of insulin-like growth factor II.
19136503 2011 Polymorphisms in the IGF1 signalling pathway including the myostatin gene are associated with left ventricular mass in male athletes.
19124510 2009 Insulin-like growth factor-1- and interleukin-6-related gene variation and risk of multiple myeloma.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
19041240 2009 Lead identification to generate 3-cyanoquinoline inhibitors of insulin-like growth factor receptor (IGF-1R) for potential use in cancer treatment.
19033715 2009 Relationships of insulin-like growth factor-1 receptor and epidermal growth factor receptor expression to clinical outcomes in patients with colorectal cancer.
19020730 2008 TAE226, a dual inhibitor for FAK and IGF-IR, has inhibitory effects on mTOR signaling in esophageal cancer cells.
18992263 2009 Colon tumor mutations and epigenetic changes associated with genetic polymorphism: insight into disease pathways.
18949375 2008 Co-targeting the EGFR and IGF-IR with anti-EGFR monoclonal antibody ICR62 and the IGF-IR tyrosine kinase inhibitor NVP-AEW541 in colorectal cancer cells.
18938767 2008 Elevated insulin-like growth factor 1 receptor, hepatocyte growth factor receptor and telomerase protein expression in mild ulcerative colitis.
18931647 2009 Hyperinsulinemic hypoglycemia with nesidioblastosis: histologic features and growth factor expression.
18832736 2008 B cells from patients with Graves' disease aberrantly express the IGF-1 receptor: implications for disease pathogenesis.
18829558 2008 Heterogeneity of receptor function in colon carcinoma cells determined by cross-talk between type I insulin-like growth factor receptor and epidermal growth factor receptor.
18788919 2008 Unique attributes of orbital fibroblasts and global alterations in IGF-1 receptor signaling could explain thyroid-associated ophthalmopathy.
18768899 2008 Evidence for an association between thyroid-stimulating hormone and insulin-like growth factor 1 receptors: a tale of two antigens implicated in Graves' disease.
18766208 2008 Immunohistochemical evaluation of insulin-like growth factor I receptor status in cervical cancer specimens.
18723765 2008 The ubiquitin ligase Nedd4 mediates oxidized low-density lipoprotein-induced downregulation of insulin-like growth factor-1 receptor.
18711691 2008 Differential expression of IGF-I and insulin receptor isoforms in HPV positive and negative human cervical cancer cell lines.
18708119 2008 Human microvascular endothelial cells are sensitive to IGF-I but resistant to insulin at the receptor level.
18693051 2009 Changes in insulin and IGF-I receptor expression during differentiation of human preadipocytes.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18683043 2009 Low activation of Insulin-like Growth Factor 1-Receptor (IGF1R) is associated with local recurrence in early breast carcinoma.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18636198 2008 Clinicopathological significance of the gene expression of matrix metalloproteinase-7, insulin-like growth factor-1, insulin-like growth factor-2 and insulin-like growth factor-1 receptor in patients with colorectal cancer: insulin-like growth factor-1 receptor gene expression is a useful predictor of liver metastasis from colorectal cancer.
18636124 2008 Polymorphisms in the estrogen receptor 1 and vitamin C and matrix metalloproteinase gene families are associated with susceptibility to lymphoma.
18632619 2008 Identification of c-Cbl as a new ligase for insulin-like growth factor-I receptor with distinct roles from Mdm2 in receptor ubiquitination and endocytosis.
18616667 2008 Insulin and insulin-like growth factor resistance in alcoholic neurodegeneration.
18611244 2008 The aromatase inhibitor letrozole and inhibitors of insulin-like growth factor I receptor synergistically induce apoptosis in in vitro models of estrogen-dependent breast cancer.
18599112 2008 MVP expression is related to IGF1-R in cervical carcinoma patients treated by radiochemotherapy.
18593464 2008 Novel splice variants derived from the receptor tyrosine kinase superfamily are potential therapeutics for rheumatoid arthritis.
18566589 2008 Small-molecule inhibition and activation-loop trans-phosphorylation of the IGF1 receptor.
18562769 2008 Genetic variation in insulin-like growth factors and brain tumor risk.
18538283 2008 Polymorphisms in the IGF1 and IGF1R genes and children born small for gestational age: results of large population studies.
18537183 2008 Autocrine insulin-like growth factor-II stimulation of tumor cell migration is a progression step in human hepatocarcinogenesis.
18535748 2008 Knockdown of insulin-like growth factor 1 receptor enhances chemosensitivity to cisplatin in human lung adenocarcinoma A549 cells.
18508432 2008 The type I insulin-like growth factor receptor pathway: a key player in cancer therapeutic resistance.
18501599 2008 Lead identification to generate isoquinolinedione inhibitors of insulin-like growth factor receptor (IGF-1R) for potential use in cancer treatment.
18492705 2008 A low concentration of genistein induces estrogen receptor-alpha and insulin-like growth factor-I receptor interactions and proliferation in uterine leiomyoma cells.
18491034 2008 Phosphoenolpyruvate-dependent inhibition of collagen biosynthesis, alpha2beta1 integrin and IGF-I receptor signaling in cultured fibroblasts.
18483367 2008 Impact of insulin-like growth factor type 1 receptor, epidermal growth factor receptor, and HER2 expressions on outcomes of patients with gastric cancer.
18477064 2008 Insulin-like growth factor-1 receptor polymorphism and ischemic stroke: a case-control study in Chinese population.
18469701 2008 Association of a single nucleotide polymorphism in the insulin-like growth factor-1 receptor gene with spinal disc degeneration in postmenopausal Japanese women.
18458087 2008 Akt regulates the survival of vascular smooth muscle cells via inhibition of FoxO3a and GSK3.
18452152 2008 Alterations in RNA-binding activities of IRES-regulatory proteins as a mechanism for physiological variability and pathological dysregulation of IGF-IR translational control in human breast tumor cells.
18451178 2008 Conditional deletion of insulin-like growth factor-I receptor in prostate epithelium.
18418709 2009 Detection and downregulation of type I IGF receptor expression by antibody-conjugated quantum dots in breast cancer cells.
18413316 2008 Decorin regulates endothelial cell motility on collagen I through activation of insulin-like growth factor I receptor and modulation of alpha2beta1 integrin activity.
18349294 2008 Risk of testicular germ cell tumors and polymorphisms in the insulin-like growth factor genes.
18316725 2008 Functionally significant insulin-like growth factor I receptor mutations in centenarians.
18267106 2008 Differential roles of SS18-SSX fusion gene and insulin-like growth factor-1 receptor in synovial sarcoma cell growth.
18263593 2008 FAK and IGF-IR interact to provide survival signals in human pancreatic adenocarcinoma cells.
18249219 2008 Interaction of single nucleotide polymorphisms in ADRB2, ADRB3, TNF, IL6, IGF1R, LIPC, LEPR, and GHRL with physical activity on the risk of type 2 diabetes mellitus and changes in characteristics of the metabolic syndrome: The Finnish Diabetes Prevention Study.
18216278 2008 UVB-induced senescence in human keratinocytes requires a functional insulin-like growth factor-1 receptor and p53.
18196535 2008 Differential localization of MT1-MMP in human prostate cancer tissue: role of IGF-1R in MT1-MMP expression.
18178561 2008 TRAIL stimulates proliferation of vascular smooth muscle cells via activation of NF-kappaB and induction of insulin-like growth factor-1 receptor.
18095062 2008 Relationships between the insulin-like growth factor I (IGF-I) receptor gene G3174A polymorphism, serum IGF-I levels, and bone mineral density in postmenopausal Korean women.
18079201 2008 Substrate-bound insulin-like growth factor (IGF)-I-IGF binding protein-vitronectin-stimulated breast cell migration is enhanced by coactivation of the phosphatidylinositide 3-Kinase/AKT pathway by alphav-integrins and the IGF-I receptor.
18079194 2008 Abnormalities of insulin-like growth factor-I signaling and impaired cell proliferation in osteoblasts from subjects with osteoporosis.
18064302 2008 Selective inhibition of proprotein convertases represses the metastatic potential of human colorectal tumor cells.
18059487 2008 UVB-induced activation of NF-kappaB is regulated by the IGF-1R and dependent on p38 MAPK.
18050122 Assessment of the contribution of insulin-like growth factor I receptor 3174 G-->A polymorphism to the progression of advanced retinopathy of prematurity.
17975158 2007 Targeting heat shock protein 90 in pancreatic cancer impairs insulin-like growth factor-I receptor signaling, disrupts an interleukin-6/signal-transducer and activator of transcription 3/hypoxia-inducible factor-1alpha autocrine loop, and reduces orthotopic tumor growth.
17972051 2007 Association of gastric cancer with tyrosine hydroxylase gene polymorphism in a northwestern Chinese population.
17956902 2008 Construction and characterization of single-chain antibodies against human insulin-like growth factor-I receptor from hybridomas producing 1H7 or 3B7 monoclonal antibody.
17918158 2008 Curcumin enhances the effects of 5-fluorouracil and oxaliplatin in mediating growth inhibition of colon cancer cells by modulating EGFR and IGF-1R.
17899316 2008 Protective effect of hyaluronic acid on interleukin-1-induced deregulation of beta1-integrin and insulin-like growth factor-I receptor signaling and collagen biosynthesis in cultured human chondrocytes.
17898946 2007 Study on insulin resistance and genetic polymorphisms in essential hypertension patients of two different kinds of TCM constitution.
17846171 2007 A novel role for IGF-1R in p53-mediated apoptosis through translational modulation of the p53-Mdm2 feedback loop.
17786320 2007 Upregulation of IGF-2 and IGF-1 receptor expression in oral cancer cell lines.
17766039 2007 Elevated insulin-like growth factor-I receptor (IGF-IR) levels in primary breast tumors associated with BRCA1 mutations.
17761519 2007 Self-renewal of human embryonic stem cells requires insulin-like growth factor-1 receptor and ERBB2 receptor signaling.
17724138 2007 Aldosterone induces elastin production in cardiac fibroblasts through activation of insulin-like growth factor-I receptors in a mineralocorticoid receptor-independent manner.
17649826 Expression of insulin-like growth-factor-1 receptor (IGF-1R) in peripheral nerve sheath tumors in neurofibromatosis type 1.
17640993 2007 Rho guanosine 5'-triphosphatases differentially regulate insulin-like growth factor I (IGF-I) receptor-dependent and -independent actions of IGF-II on human trophoblast migration.
17634559 2007 Insulin-like growth factor receptor as a therapeutic target in head and neck cancer.
17627944 2007 Insulin-like growth factor-I receptor mediates the prosurvival effect of fibronectin.
17624760 2007 The insulin-like growth factor 1 receptor in cancer: old focus, new future.
17620336 2007 The insulin-like growth factor type 1 and insulin-like growth factor type 2/mannose-6-phosphate receptors independently regulate ERK1/2 activity in HEK293 cells.
17586502 2007 Autoinhibition of the insulin-like growth factor I receptor by the juxtamembrane region.
17568996 2007 Dual targeting of IGF-1R and PDGFR inhibits proliferation in high-grade gliomas cells and induces radiosensitivity in JNK-1 expressing cells.
17560756 2007 Thyroid hormone receptor and IGF1/IGFR systems: possible relations in the human heart.
17525128 2007 Estrogen signaling via a linear pathway involving insulin-like growth factor I receptor, matrix metalloproteinases, and epidermal growth factor receptor to activate mitogen-activated protein kinase in MCF-7 breast cancer cells.
17524361 2007 The insulin-like growth factor 1 (IGF-1) receptor is a substrate for gamma-secretase-mediated intramembrane proteolysis.
17486080 2007 The VHL tumor suppressor inhibits expression of the IGF1R and its loss induces IGF1R upregulation in human clear cell renal carcinoma.
17442315 2007 Association of the GAA1013-->GAG polymorphism of the insulin-like growth factor-1 receptor (IGF1R) gene with premature pubarche.
17419944 2007 Control of apoptosis in human multiple myeloma by insulin-like growth factor I (IGF-I).
17418605 2007 Over-expression of IGF-related peptides in stenoses of native arteriovenous fistulas in hemodialysis patients.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17349528 Expression of insulin-like growth factor-1 receptor in local and metastatic prostate cancer.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17320820 2007 Dual silencing of the EGF and type 1 IGF receptors suggests dominance of IGF signaling in human breast cancer cells.
17317169 2007 Discovery and initial SAR of 3-(1H-benzo[d]imidazol-2-yl)pyridin-2(1H)-ones as inhibitors of insulin-like growth factor 1-receptor (IGF-1R).
17307140 2007 The EGF receptor interacts with the type 1 IGF receptor and regulates its stability.
17296734 2007 Constitutively active type I insulin-like