Property Summary

NCBI Gene PubMed Count 10
PubMed Score 9.26
PubTator Score 10.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Breast cancer 2.500 2.6e-02
chronic rhinosinusitis -1.177 3.8e-02
group 4 medulloblastoma -1.100 2.5e-02
medulloblastoma, large-cell -1.700 2.3e-03
osteosarcoma 1.074 4.6e-03
ovarian cancer -1.500 5.7e-06
Pick disease -1.600 5.5e-04
progressive supranuclear palsy -1.600 1.5e-02

Gene RIF (3)

AA Sequence

MRLKISLLKEPKHQELVSCVGWTTAEELYSCSDDHQIVKWNLLTSETTQIVKLPDDIYPIDFHWFPKSLG      1 - 70
VKKQTQAESFVLTSSDGKFHLISKLGRVEKSVEAHCGAVLAGRWNYEGTALVTVGEDGQIKIWSKTGMLR     71 - 140
STLAQQGTPVYSVAWGPDSEKVLYTAGKQLIIKPLQPNAKVLQWKAHDGIILKVDWNSVNDLILSAGEDC    141 - 210
KYKVWDSYGRPLYNSQPHEHPITSVAWAPDGELFAVGSFHTLRLCDKTGWSYALEKPNTGSIFNIAWSID    211 - 280
GTQIAGACGNGHVVFAHVVEQHWEWKNFQVTLTKRRAMQVRNVLNDAVDLLEFRDRVIKASLNYAHLVVS    281 - 350
TSLQCYVFSTKNWNTPIIFDLKEGTVSLILQAERHFLLVDGSSIYLYSYEGRFISSPKFPGMRTDILNAQ    351 - 420
TVSLSNDTIAIRDKADEKIIFLFEASTGKPLGDGKFLSHKNEILEIALDQKGLTNDRKIAFIDKNRDLCI    421 - 490
TSVKRFGKEEQIIKLGTMVHTLAWNDTCNILCGLQDTRFIVWYYPNTVYVDRDILPKTLYERDASEFSKN    491 - 560
PHIVSFVGNQVTIRRADGSLVHISITPYPAILHEYVSSSKWEDAVRLCRFVKEQTMWACLAAMAVANRDM    561 - 630
TTAEIAYAAIGEIDKVQYINSIKNLPSKESKMAHILLFSGNIQEAEIVLLQAGLVYQAIQININLYNWER    631 - 700
ALELAVKYKTHVDTVLAYRQKFLETFGKQETNKRYLHYAEGLQIDWEKIKAKIEMEITKEREQSSSSQSS    701 - 770
KSIGLKP                                                                   771 - 777
//

Text Mined References (11)

PMID Year Title