Property Summary

NCBI Gene PubMed Count 16
PubMed Score 14.89
PubTator Score 9.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma -1.200 7.5e-06
astrocytic glioma 1.300 7.6e-03
ependymoma 2.200 8.4e-03
oligodendroglioma 1.400 1.4e-02
psoriasis -1.200 9.7e-03
osteosarcoma -1.267 3.5e-04
medulloblastoma 1.100 1.7e-04
tuberculosis 1.400 2.9e-07
lung cancer -1.100 1.3e-03

Gene RIF (1)

PMID Text
24488770 Study coupled human genetics with functional validation in zebrafish and identified IFT27 as a novel BBS gene (BBS19).

AA Sequence

MVKLAAKCILAGDPAVGKTALAQIFRSDGAHFQKSYTLTTGMDLVVKTVPVPDTGDSVELFIFDSAGKEL      1 - 70
FSEMLDKLWESPNVLCLVYDVTNEESFNNCSKWLEKARSQAPGISLPGVLVGNKTDLAGRRAVDSAEARA     71 - 140
WALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEVFRALA                            141 - 186
//

Text Mined References (16)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
25443296 2014 The intraflagellar transport protein IFT27 promotes BBSome exit from cilia through the GTPase ARL6/BBS3.
25416956 2014 A proteome-scale map of the human interactome network.
24488770 2014 IFT27, encoding a small GTPase component of IFT particles, is mutated in a consanguineous family with Bardet-Biedl syndrome.
22022256 2011 Thousands of rab GTPases for the cell biologist.
21269460 2011 Initial characterization of the human central proteome.
17276912 2007 Intraflagellar transport protein 27 is a small G protein involved in cell-cycle control.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12529303 2003 Reevaluating human gene annotation: a second-generation analysis of chromosome 22.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.