Property Summary

NCBI Gene PubMed Count 20
PubMed Score 9.62
PubTator Score 7.57

Knowledge Summary

Patent

No data available

Gene RIF (13)

PMID Text
22192711 Studies indicate that upregulation of the type I interferon protein signature has added additional markers of disease activity and insight into the pathogenesis of the disease.
21854986 The crystal structures of two human type I IFN ternary signaling complexes containing IFNalpha2 and IFNomega reveal recognition modes and heterotrimeric architectures that are unique among the cytokine receptor superfamily but conserved between type I IFNs.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20588308 Observational study of gene-disease association. (HuGE Navigator)
20574843 Single nucleotide polymorphism in ACO1 gene is associated with skin pigmentation.
20574843 Observational study of gene-disease association. (HuGE Navigator)
20331378 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19863576 Data show that a novel c.1344delC mutation in AIRE and anti-IFN-omega antibodies appear very early in life are helpful to differentiate APS I from other multi-organ autoimmune diseases.
16504056 Observational study of gene-disease association. (HuGE Navigator)
15621727 type I interferons interact with receptor components results and have roles in the activation of a number of signaling pathways [review]
12089333 HIV-1 gp120 modulates expression of the cytokines IL1beta, IL3, IL6, IL10, IL13, IL15, IFNbeta2A, IFNgamma, IFNomega, TNFalpha, VEGF, VEGF B, and LIF in PBMCs and MDMs
7913356 HIV-1 gp120 modulates expression of the cytokines IL1beta, IL3, IL6, IL10, IL13, IL15, IFNbeta2A, IFNgamma, IFNomega, TNFalpha, VEGF, VEGF B, and LIF in PBMCs and MDMs

AA Sequence

MALLFPLLAALVMTSYSPVGSLGCDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFRFPQEMVKGSQ      1 - 70
LQKAHVMSVLHEMLQQIFSLFHTERSSAAWNMTLLDQLHTGLHQQLQHLETCLLQVVGEGESAGAISSPA     71 - 140
LTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTNMQERLRSKDRDLGSS                   141 - 195
//

Text Mined References (23)

PMID Year Title
22192711 2011 Type I interferon pathway in adult and juvenile dermatomyositis.
21854986 2011 Structural linkage between ligand discrimination and receptor activation by type I interferons.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20588308 2010 Dengue hemorrhagic fever is associated with polymorphisms in JAK1.
20574843 2010 Associations of 9p21 variants with cutaneous malignant melanoma, nevi, and pigmentation phenotypes in melanoma-prone families with and without CDKN2A mutations.
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19863576 2010 Novel sequence variation of AIRE and detection of interferon-omega antibodies in early infancy.
16504056 2006 Polymorphism discovery and association analyses of the interferon genes in type 1 diabetes.
15621727 2004 Human interferons alpha, beta and omega.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15164053 2004 DNA sequence and analysis of human chromosome 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10835682 2000 Limitin: An interferon-like cytokine that preferentially influences B-lymphocyte precursors.
8142025 1993 Cloning, sequencing and expression in E. coli of interferon-omega 1 gene.
7765487 1994 Identification of glycosylated subtypes of interferon-alpha produced by human leukocytes.
3895159 1985 A novel class of human type I interferons.
2985969 1985 Two distinct families of human and bovine interferon-alpha genes are coordinately expressed and encode functional polypeptides.
1834641 1991 Human interferon omega (omega) binds to the alpha/beta receptor.
1693148 1990 Purification and characterization of natural human interferon omega 1. Two alternative cleavage sites for the signal peptidase.
1647209 1991 Human interferon omega 1: isolation of the gene, expression in Chinese hamster ovary cells and characterization of the recombinant protein.
1385305 1992 Mapping of the shortest region of overlap of deletions of the short arm of chromosome 9 associated with human neoplasia.