Property Summary

NCBI Gene PubMed Count 20
PubMed Score 10.62
PubTator Score 7.57

Knowledge Summary

Patent

No data available

Expression

Gene RIF (13)

AA Sequence

MALLFPLLAALVMTSYSPVGSLGCDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFRFPQEMVKGSQ      1 - 70
LQKAHVMSVLHEMLQQIFSLFHTERSSAAWNMTLLDQLHTGLHQQLQHLETCLLQVVGEGESAGAISSPA     71 - 140
LTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTNMQERLRSKDRDLGSS                   141 - 195
//

Text Mined References (23)

PMID Year Title