Property Summary

NCBI Gene PubMed Count 31
PubMed Score 33.11
PubTator Score 34.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
psoriasis 6685 3.097 1.5
Disease Target Count Z-score Confidence
Hepatitis C 90 3.017 1.5

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 2.093 1.6e-08
posterior fossa group B ependymoma 2.000 2.3e-07
adult high grade glioma 1.100 1.6e-02
pilocytic astrocytoma 1.200 5.6e-03
Breast cancer -1.300 2.3e-09
facioscapulohumeral dystrophy 1.600 2.3e-02

Protein-protein Interaction (3)

Gene RIF (24)

PMID Text
27166550 Selective expression of IFNlambdaR1 was considered to be a plus point towards the targeted anti-viral activity of IFNlambdas but artificial control on its expression will surely make IFNlambdas a better drug with enhanced activity.
26400298 Polymorphism within the IL-28R1, but not in IL-28B, is associated with benign prostatic hyperplasia and lower urinary tract symptoms in Chinese.
25911176 expression of IL-28RA mRNA may be correlated with the pathogenesis of systemic lupus erythematosus
24752298 IFN-lambda receptor 1 expression is induced in chronic hepatitis C and correlates with the IFN-lambda3 genotype and with nonresponsiveness to IFN-alpha therapies.
24510368 This study is the first to show the activation of a type III interferon response in low-risk human papillomavirus positive cervical cells and suggests that the lack of this response may be related to lesion progression.
24438680 IL28RA polymorphism (rs10903035) seems to be implicated in the glucose homeostasis because AA genotype increases the likelihood of IR, but this association was different depending on hepatic fibrosis and HCV genotype.
24409098 Epigenetic reprogramming of IFNLR1-mediated response potentiates antiviral activity and suppresses tumor growth.
24144988 Results show that the distribution of IL10RB and IL28RA genotypes among the Hepatitis C virus-infected and control groups did not differ significantly.
23565619 The rs12980275 AG/GG genotype and rs10903035 G allele remained independently associated with early pegylated interferon and ribavirin failure of hepatitis C in hepatitis C/HIV coinfected patients.
22891284 Plasmacytoid dendritic cells are major producers of IFN-lambda2 (a type III interferon) in response to viral stimulation and also express functional receptors for this cytokine.
22386267 No consistent association is found between IL28RA and multiple sclerosis in a Basque-Spanish population.
21742059 two SNPs in IL28RA are correlated with susceptibility to HCV infection and spontaneous viral clearance, which implicates a primary role of IL28RA in the outcomes of HCV infection
20953190 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20934432 IFN-lambdaR1 consists of two distinct domains having fibronectin type III topology.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20057073 Although the IFN-lambda1(Bac)-IFN-lambda1R1 and IFN-lambda1(Ins)-IFN-lambda1R1 complexes differed only in the nature of the expression system used for the ligand, their crystallization conditions and crystal forms were quite different
19798076 study supports that IFN-lambdas do not influence every type of cell and that membrane-associated variant IFN-lambda R1 expression is not sufficient to ensure cellular sensitivity toward these cytokines.
19724244 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
16819289 Observational study of gene-disease association. (HuGE Navigator)
16819289 Results suggested that the g.32349 G>A polymorphism of IL-28RA might be associated with susceptibility to allergic rhinitis.
15166220 interleukin (IL)-28 receptor tyrosine residues have roles in antiviral and antiproliferative activity of IL-29/interferon-lambda 1
12483210 distinct receptor complex that is utilized by all three IFN-lambda proteins for signaling and is composed of two subunits, a receptor designated CRF2-12 (also designated as IFN-lambdaR1) and a second subunit, CRF2-4 (also known as IL-10R2)
12469119 IL-28 and IL-29 interact with a heterodimeric class II cytokine receptor that consisted of IL-10 receptor beta (IL-10Rbeta) and an orphan class II receptor chain, designated IL-28Ralpha.

AA Sequence

MAGPERWGPLLLCLLQAAPGRPRLAPPQNVTLLSQNFSVYLTWLPGLGNPQDVTYFVAYQSSPTRRRWRE      1 - 70
VEECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLFEVEPAPPVLVLTQTEEILS     71 - 140
ANATYQLPPCMPPLDLKYEVAFWKEGAGNKTLFPVTPHGQPVQITLQPAASEHHCLSARTIYTFSVPKYS    141 - 210
KFSKPTCFLLEVPEANWAFLVLPSLLILLLVIAAGGVIWKTLMGNPWFQRAKMPRALDFSGHTHPVATFQ    211 - 280
PSRPESVNDLFLCPQKELTRGVRPTPRVRAPATQQTRWKKDLAEDEEEEDEEDTEDGVSFQPYIEPPSFL    281 - 350
GQEHQAPGHSEAGGVDSGRPRAPLVPSEGSSAWDSSDRSWASTVDSSWDRAGSSGYLAEKGPGQGPGGDG    351 - 420
HQESLPPPEFSKDSGFLEELPEDNLSSWATWGTLPPEPNLVPGGPPVSLQTLTFCWESSPEEEEEARESE    421 - 490
IEDSDAGSWGAESTQRTEDRGRTLGHYMAR                                            491 - 520
//

Text Mined References (33)

PMID Year Title
27166550 2016 Unraveling the molecular mechanism governing the tissue specific expression of IFN?R1.
26400298 2015 Association of polymorphism within the interleukin-28 receptor alpha gene, but not in interleukin-28B, with lower urinary tract symptoms (LUTS) in Chinese.
25911176 2015 Increased expression of IL-28RA mRNA in peripheral blood mononuclear cells from patients with systemic lupus erythematosus.
24752298 2014 IFN-? receptor 1 expression is induced in chronic hepatitis C and correlates with the IFN-?3 genotype and with nonresponsiveness to IFN-? therapies.
24510368 2014 Interferon lambda 1 expression in cervical cells differs between low-risk and high-risk human papillomavirus-positive women.
24438680 2014 IL28RA polymorphism (rs10903035) is associated with insulin resistance in HIV/HCV-coinfected patients.
24409098 2014 Epigenetic reprogramming of the type III interferon response potentiates antiviral activity and suppresses tumor growth.
24144988 2014 Evaluation of the relationship between IL28B, IL10RB and IL28RA single-nucleotide polymorphisms and susceptibility to hepatitis C virus in Chinese Han population.
23565619 2013 IL28RA polymorphism is associated with early hepatitis C virus (HCV) treatment failure in human immunodeficiency virus-/HCV-coinfected patients.
22891284 2012 Type III IFNs are produced by and stimulate human plasmacytoid dendritic cells.
22386267 2012 Analysis of the IL28RA locus as genetic risk factor for multiple sclerosis.
21844884 2013 Genome-wide meta-analysis identifies variants associated with platinating agent susceptibility across populations.
21742059 2011 Genetic variation in IL28RA is associated with the outcomes of HCV infection in a high-risk Chinese population.
20953190 2010 A genome-wide association study identifies new psoriasis susceptibility loci and an interaction between HLA-C and ERAP1.
20934432 2010 Crystal structure of human interferon-?1 in complex with its high-affinity receptor interferon-?R1.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20057073 2010 Purification, crystallization and preliminary crystallographic studies of the complex of interferon-lambda1 with its receptor.
19798076 2009 Despite IFN-lambda receptor expression, blood immune cells, but not keratinocytes or melanocytes, have an impaired response to type III interferons: implications for therapeutic applications of these cytokines.
19724244 2009 Genome-wide association study of suicidal ideation emerging during citalopram treatment of depressed outpatients.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
16819289 2006 Analysis of the variations in IL-28RA gene and their association with allergic rhinitis.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16618774 2006 Characterization of the mouse IFN-lambda ligand-receptor system: IFN-lambdas exhibit antitumor activity against B16 melanoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231747 2004 A protein interaction framework for human mRNA degradation.
15166220 2004 Role of the interleukin (IL)-28 receptor tyrosine residues for antiviral and antiproliferative activity of IL-29/interferon-lambda 1: similarities with type I interferon signaling.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12521379 2003 Cloning of a new type II cytokine receptor activating signal transducer and activator of transcription (STAT)1, STAT2 and STAT3.
12483210 2003 IFN-lambdas mediate antiviral protection through a distinct class II cytokine receptor complex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12469119 2003 IL-28, IL-29 and their class II cytokine receptor IL-28R.
1248321 1976 [Herniation of the muscles in lower limbs in children].