Property Summary

NCBI Gene PubMed Count 44
PubMed Score 0.00
PubTator Score 8.00

Knowledge Summary

Patent

No data available

TINX Plot

Gene RIF (41)

PMID Text
26896692 suggest that IFN-lambda4 protein expression associated with the IL28B-T/T variant preactivates the Janus kinase-Stat signaling
26741362 The described is the association with spontaneous hepatitis C viral clearance and genetic differentiation of IL28B/IFNL4 haplotypes in populations from Mexico.
26684959 this report shows that NF-kappa B, IRF3, IRF7, and the GC-rich DNA-binding transcription factor, Sp1, have key roles in stimulating transcription from the IFNL4 promoter.
26606750 data on ex vivo derived liver tissue samples argue against an attenuating impact of IFNL3 rs4803217 or IFNL4 rs368234815 minor alleles on hepatic IFNL3 gene expression in vivo.
26431156 IFNL4-DeltaG/TT genotype was not associated with HSV-related outcomes, including episodes of oral or genital herpes
26406534 Single-nucleotide polymorphisms (SNPs) in the interferon lambda 4 (IFNL4) gene are predictors for treatment success in patients with hepatitis C virus (HCV) infection
26372394 The hepatitis C protective allele TT was associated with decreased likelihood of HIV-1 infection in male intravenous drug users [odds ratio (OR): 0.3; P = 0.006], and this association was not modified by the genotype of CCR5.
26308395 Despite differences in protein sequences, functional properties of the recombinant human and nonhuman IFN-l4 proteins are comparable-they are all biologically active for induction of interferon signaling.
26225703 Single Nucleotide Polymorphism of Interferon Lambda-4 Gene is not Associated with Treatment Response to Pegylated Interferon in Chronic Hepatitis B.
26194286 Studies indicate that the type III interferons (IFNs) or IFN-lambdas consists of four members: IFN-lambda1 (IL-29), IFN-lambda2 (IL28A), IFN-lambda3 (IL-28B) and IFN-lambda4.
26150150 IFNL3 and IFNL4 genotyping could identify those likely to clear naturally and in whom treatment could be delayed, or help prioritize Directly-acting antivirals treatment to those less likely to respond to interferon-containing regimens.
26134097 IFN-l4 may have at least 3 functions in human hepatic cells-activation of interferon signaling, inhibition of cell proliferation, and induction of cell death
26115445 The current study is the first to investigate the effect of IFNL3 and IFNL4 polymorphisms on liver-related mortality. The lower risk of death among African American HIV/HCV-coinfected women is not explained by genetic variation in the IFN-lambda region.
26066369 Transcriptome analysis reveals a classical interferon signature induced by IFNlambda4 in human primary cells
25938236 IFNL4 polymorphisms were predictive of treatment outcome only for patients infected with HCV-1.
25883387 Females with the IFNL4 genotype detected were more likely to have HCV reclearance.
25849245 HCV infection is proposed to induce a more efficient antiviral response in individuals with the IFNL4 TT/TT genotype that results either in viral clearance or selection for viral adaptations.
25788203 The IFNL3.rs12979860 and IFNL4.ss469415590 variants have comparable effects on spontaneous resolution of hepatitis C virus infection among Egyptians.
25740255 Interferon-lambda rs12979860 genotype is a strong aetiology-independent predictor of tissue inflammation and fibrosis in viral and non-viral chronic liver disease.
25675103 IFNL4 and IFNL3 associated polymorphisms strongly influence the spontaneous IFN-alpha receptor-1 expression in HCV-infected patients
25658540 We found an independent association of the IFNL4 ss469415590 polymorphism with higher prevalence of AIDS-defining illnesses and lower CD4 T cell numbers.
25611696 Overexpression of IFNlambda4 suppressed IL28B induction and promoter activation.
25577150 Genetic analysis revealed associations of rs368234815 of IFNL4 with sustained virological response and pre-treatment viral load.
25563035 Among Puerto Rican hepatitis C patients, SNP frequencies of IFNL4 locus ss469415590 were 26% (TT/TT), 48% (TT/DeltaG), and 26% (DeltaG/DeltaG).
25534433 Patients harbouring the impaired IFNlambda4-S70 variant display lower interferon-stimulated gene (ISG) expression levels.
25393304 IFNL4 gene polymorphisms can predict treatment response in chronic hepatitis C.
25329461 Natural selection history of IFNL4-inactivating allele has thus shaped present-day heterogeneity across populations not only in genetic variation, but also in relevant phenotypes and susceptibility to hepatitis C.
25301956 Polymorphisms in the IFNL3/4 region influence susceptibility to cytomegalovirus replication in solid-organ transplant recipients.
25259701 Authors report for the first time an association between an IFNL3/4 polymorphism and susceptibility to AIDS-related cytomegalovirus retinitis.
25130512 This study demonstrates that IFNL4 rs368234815 polymorphism is an important predictor of response to antiviral treatment in the liver transplantation setting.
24786669 this review summarizes the current knowledge of IFN-l4 and discusses questions that should be addressed to resolve its paradoxical biologic activities.[review]
24782280 IFNL3 and IFNL4 single nucleotide polymorphisms correlate with treatment response in hepatitis C patients depending on virus genotype.
24646752 could not find any difference in the predictive impact of any of three SNPs of IFNL4 or IL-28B with regard to susceptibility to HCV or treatment response
24415789 Intrahepatic lymphocyte degranulation activity in HCV-infected patients is associated with IFNL4 polymorphisms and contributes to the clearance of HCV in patients with favorable genotypes under antiviral therapy.
24376784 HCV infection in particular might activate IFNL4 transcription in the liver
24367041 It was reported that in patients treated with sofosbuvir along with ribavirin, IFNL4-DeltaG is associated with slower early viral decay, due to slower loss of free virus and decreased drug efficacy.
24355007 genetic polymorphism is associated with antiviral therapy outcome in the Japanese population
24325405 Its polymorphisms are strongly associated with responses to pegylated interferon (PEG-IFN) and ribavirin (RBV) therapy in patients chronically infected with hepatitis C virus.
24205831 IFNL4 improves prediction of response to interferon-based hepatitis C therapies, if SNP rs8099917 is used.
23956438 IFNL4-DeltaG is strongly associated with impaired spontaneous hepatitis C virus clearance.
23291588 A new interferon gene IFNL4 is associated with impaired clearance of hepatitis C virus.

AA Sequence

MRPSVWAAVAAGLWVLCTVIAAAPRRCLLSHYRSLEPRTLAAAKALRDRYEEEALSWGQRNCSFRPRRDP      1 - 70
PRPSSCARLRHVARGIADAQAVLSGLHRSELLPGAGPILELLAAAGRDVAACLELARPGSSRKVPGAQKR     71 - 140
RHKPRRADSPRCRKASVVFNLLRLLTWELRLAAHSGPCL                                   141 - 179
//

Text Mined References (45)

PMID Year Title
26896692 2016 Cellular Mechanism for Impaired Hepatitis C Virus Clearance by Interferon Associated with IFNL3 Gene Polymorphisms Relates to Intrahepatic Interferon-? Expression.
26741362 2016 Association with Spontaneous Hepatitis C Viral Clearance and Genetic Differentiation of IL28B/IFNL4 Haplotypes in Populations from Mexico.
26684959 Roles for Transcription Factors Sp1, NF-?B, IRF3, and IRF7 in Expression of the Human IFNL4 Gene.
26606750 2015 Hepatic Interferon-?3 (IFNL3) Gene Expression Reveals Not to Be Attenuated in Non-Favorable IFNL3 rs4803217 or IFNL4 rs368234815 Minor Allele Carriers in Chronic Hepatitis C.
26431156 2015 Interferon Lambda 4 Genotype Is Not Associated with Recurrence of Oral or Genital Herpes.
26406534 2016 Interferon lambda 4 genotypes and resistance-associated variants in patients infected with hepatitis C virus genotypes 1 and 3.
26372394 2015 IFNL4 rs368234815 polymorphism is associated with innate resistance to HIV-1 infection.
26308395 2016 Comparative Functional Analysis of 12 Mammalian IFN-?4 Orthologs.
26225703 2015 Single Nucleotide Polymorphism of Interferon Lambda-4 Gene is not Associated with Treatment Response to Pegylated Interferon in Thai Patients with Chronic Hepatitis B.
26194286 2015 Guarding the frontiers: the biology of type III interferons.
26186989 2015 Comparison of functional variants in IFNL4 and IFNL3 for association with HCV clearance.
26150150 2015 Interferon ? 3 and 4 Genotyping Using High-Resolution Melt Curve Analysis Suitable for Multiple Clinical Sample Types.
26134097 2015 Expression of Interferon Lambda 4 Is Associated with Reduced Proliferation and Increased Cell Death in Human Hepatic Cells.
26115445 2015 Association of IFNL3 and IFNL4 polymorphisms with liver-related mortality in a multiracial cohort of HIV/HCV-coinfected women.
26066369 2015 Transcriptome analysis reveals a classical interferon signature induced by IFN?4 in human primary cells.
25938236 2015 Prevalence of Thymine--Adenine Dinucleotide Repeat, IL28B and IFNL4 in Thai Population and Correlation with Spontaneous Clearance and Treatment Outcome of Hepatitis C Infection.
25883387 2015 Hepatitis C Virus Reinfection and Spontaneous Clearance of Reinfection--the InC3 Study.
25849245 2015 Association between variants in the interferon lambda 4 locus and substitutions in the hepatitis C virus non-structural protein 5A.
25788203 2015 Influence of IFNL3.rs12979860 and IFNL4.ss469415590 polymorphism on clearance of hepatitis C virus infection among Egyptians.
25740255 2015 Interferon-? rs12979860 genotype and liver fibrosis in viral and non-viral chronic liver disease.
25675103 2015 IFNL4 and IFNL3 associated polymorphisms strongly influence the spontaneous IFN-alpha receptor-1 expression in HCV-infected patients.
25658540 2015 IFNL4 ss469415590 polymorphism is associated with unfavourable clinical and immunological status in HIV-infected individuals.
25611696 2015 Impaired induction of interleukin 28B and expression of interferon ? 4 associated with nonresponse to interferon-based therapy in chronic hepatitis C.
25577150 2015 Interferon-?4 is a cell-autonomous type III interferon associated with pre-treatment hepatitis C virus burden.
25563035 2014 Demographics, clinical characteristics, IFNL3- and IFNL4- polymorphisms in a cohort of hepatitis C patients from Puerto Rico.
25534433 2014 Reduced IFN?4 activity is associated with improved HCV clearance and reduced expression of interferon-stimulated genes.
25393304 2014 Predictive value of interferon-lambda gene polymorphisms for treatment response in chronic hepatitis C.
25329461 2014 Selection on a variant associated with improved viral clearance drives local, adaptive pseudogenization of interferon lambda 4 (IFNL4).
25301956 2015 Influence of IFNL3/4 polymorphisms on the incidence of cytomegalovirus infection after solid-organ transplantation.
25259701 2014 The IFNL3/4 ?G variant increases susceptibility to cytomegalovirus retinitis among HIV-infected patients.
25130512 2014 IFNL4 polymorphism predicts response to hepatitis C treatment after liver transplantation.
24786669 2014 IFN-?4: the paradoxical new member of the interferon lambda family.
24782280 2014 IFNL3 (IL28B) and IFNL4 polymorphisms are associated with treatment response in Thai patients infected with HCV genotype 1, but not with genotypes 3 and 6.
24646752 2014 IFNL4/IL-28B haplotype structure and its impact on susceptibility to hepatitis C virus and treatment response in the Japanese population.
24415789 2014 Lymphocytes degranulation in liver in hepatitis C virus carriers is associated with IFNL4 polymorphisms and ALT levels.
24376784 2013 Interferon-?4 (IFNL4) transcript expression in human liver tissue samples.
24367041 2014 IFNL4-?G genotype is associated with slower viral clearance in hepatitis C, genotype-1 patients treated with sofosbuvir and ribavirin.
24355007 2014 Genetic polymorphism in IFNL4 and response to pegylated interferon-? and ribavirin in Japanese chronic hepatitis C patients.
24325405 2014 Role of IL28B for chronic hepatitis C treatment toward personalized medicine.
24205831 2014 Polymorphisms of interferon-?4 and IL28B - effects on treatment response to interferon/ribavirin in patients with chronic hepatitis C.
23956438 2014 Association of the IFNL4-?G Allele With Impaired Spontaneous Clearance of Hepatitis C Virus.
23420232 2013 Genome-wide association study of spontaneous resolution of hepatitis C virus infection: data from multiple cohorts.
23291588 2013 A variant upstream of IFNL3 (IL28B) creating a new interferon gene IFNL4 is associated with impaired clearance of hepatitis C virus.
19684573 2009 Genetic variation in IL28B predicts hepatitis C treatment-induced viral clearance.
15057824 2004 The DNA sequence and biology of human chromosome 19.