Property Summary

NCBI Gene PubMed Count 60
PubMed Score 0.00
PubTator Score 8.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Gene RIF (58)

AA Sequence

MRPSVWAAVAAGLWVLCTVIAAAPRRCLLSHYRSLEPRTLAAAKALRDRYEEEALSWGQRNCSFRPRRDP      1 - 70
PRPSSCARLRHVARGIADAQAVLSGLHRSELLPGAGPILELLAAAGRDVAACLELARPGSSRKVPGAQKR     71 - 140
RHKPRRADSPRCRKASVVFNLLRLLTWELRLAAHSGPCL                                   141 - 179
//

Text Mined References (61)

PMID Year Title