Property Summary

NCBI Gene PubMed Count 33
PubMed Score 33.68
PubTator Score 10.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Gene RIF (29)

PMID Text
26353965 NS of severe fever with thrombocytopenia syndrome virus inhibited the activity of IFN-alpha1, IFN-beta, IFN-lambda1 and IFN-lambda2 through inhibition of STAT1 phosphorylation.
26194286 Studies indicate that the type III interferons (IFNs) or IFN-lambdas consists of four members: IFN-lambda1 (IL-29), IFN-lambda2 (IL28A), IFN-lambda3 (IL-28B) and IFN-lambda4.
25355870 These results show that type III interferons (IFN-lambdas) play a critical protective role in human metapneumovirus infection.
24973639 this study provides evidence for potential IL-28A participation in Behcet's diseaseand its value as a therapeutic agent.
24385435 Interferon regulatory factor (IRF)-3 and -7 are the key transcriptional factors for the induction of IL-28A and IL-28B genes, whereas NF-kappaB is an additional requirement for the induction of the IL-29 gene.
24269996 Results showed no association between genotypes and alleles of IL28A, IL28B or IL29 polymorphisms and Hepatitis C virus infection.
23652058 IL-28 genotype was not associated with response to interferon treatment (OR for GT/GG vs. TT, 0.881 (95%CI 0.388 - 2.002); P = 0.762; OR for CT/CC vs. TT, 0.902 (95%CI 0.458 - 1.778); P = 0.766).
23207147 IFN-lambdas can also directly affect T cells through inhibition of the T helper 2 cell (Th2) responses. IFN-lambdas have varying immunomodulatory functions under different physiological conditions
22962576 Elevated expression of inflammatory cytokines (IL-5, IL-20, and IL-28A) is associated with bladder cancer development.
22891284 Plasmacytoid dendritic cells are major producers of IFN-lambda2 (a type III interferon) in response to viral stimulation.
22825757 p38 MAPK pathway mediates IL-28A-induced cell migration through MMP-9 expression by activating NF-kappaB and AP-1 binding motifs.
22560878 The results show that IL-28A/IL-28AR1 dyad-induced wound healing migration requires NF-kappaB-mediated MMP-9 expression by MAPK activation.
22253847 This study aimed to 1) examine DNA sequences in IL28B surrounding each of the reported associated single nucleotide polymorphisms and the corresponding regions in IL28A.
21499846 IL-29/IL-28A suppress herpes simplex virus type 1 (HSV-1) infection of human NT2-N neurons.
21170333 In contrast to IL-29, IL-28A is a potent gene repressor in patients with hepatitis C
21145813 In general IL-29 serum levels exceeded IL-28A/B at least twofold, with IL-29 and IL-28A/B levels being significantly higher in carriers of the rs12979860 C allele than in TT homozygous individuals in hepatitis C
20576307 Observational study of gene-disease association. (HuGE Navigator)
20235331 Chronic hepatitis C patients with the rs12979860 CC responder genotype may have a lower endogenous IFN response to the virus.
19798076 study supports that IFN-lambdas do not influence every type of cell and that membrane-associated variant IFN-lambda R1 expression is not sufficient to ensure cellular sensitivity toward these cytokines.
19304895 recent findings about the biology of IFN-lambdas and their pathophysiological roles in viral infection, cancer, and immune responses of the innate and adaptive arms.[review]
19193806 These data provide direct and compelling evidence that IFN-lambda, through both extracellular and intracellular antiviral mechanisms, inhibits HIV-1 replication in macrophages.
17367910 IFNs lambda exhibit several common features with type I IFNs: antiviral activity, antiproliferative activity and in vivo antitumour activity [review]
16478884 IFN-lambdas are thus able to generate tolerogenic DCs, an activity that could thwart IFN-beta functions
16146571 IL-28A antiviral activity is associated with the activation of the JAK-STAT signaling pathway and expression of ISGs.
16051921 IECs express functional receptors for IFN-lambdas, which mediate antiviral and antiproliferative signals in IECs, suggesting a potential for therapeutic use in certain viral infections and as (antiproliferative) anticancer therapy
15899585 we found IL-28A and IL-29 act similarly to IFNs, but are less effective generally and have activity in a more limited range of cell lines
15850793 IL-28A and IL-29 induced mRNA expression of the antiviral proteins 2',5'-OAS and MxA was abolished by overexpression of SOCS-1
12483210 closely positioned genes on human chromosome 19 encode distinct but paralogous proteins, which we designate interferon-lambda1 (IFN-lambda1), IFN-lambda2 and IFN-lambda3
12469119 identified from the human genomic sequence a family of three cytokines, designated interleukin 28A (IL-28A), IL-28B and IL-29, that are distantly related to type I interferons (IFNs) and the IL-10 family

AA Sequence

MKLDMTGDCTPVLVLMAAVLTVTGAVPVARLHGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLL      1 - 70
KDCRCHSRLFPRTWDLRQLQVRERPMALEAELALTLKVLEATADTDPALVDVLDQPLHTLHHILSQFRAC     71 - 140
IQPQPTAGPRTRGRLHHWLYRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV              141 - 200
//

Text Mined References (36)

PMID Year Title
26353965 2015 Suppression of type I and type III IFN signalling by NSs protein of severe fever with thrombocytopenia syndrome virus through inhibition of STAT1 phosphorylation and activation.
26194286 2015 Guarding the frontiers: the biology of type III interferons.
25355870 2015 Impact and regulation of lambda interferon response in human metapneumovirus infection.
24973639 2014 Interleukin-28A promotes IFN-? production by peripheral blood mononuclear cells from patients with Behçet's disease.
24751921 2014 Interferon-? in the context of viral infections: production, response and therapeutic implications.
24385435 2014 Transcriptional regulation of IFN-? genes in hepatitis C virus-infected hepatocytes via IRF-3·IRF-7·NF-?B complex.
24269996 2014 Genetic polymorphisms of the IFN? genes are associated with biochemical features in Han Chinese with HCV infection from Yunnan Province, China.
23652058 2013 Gene polymorphisms of interleukin-28, p21-activated protein kinases 4, and response to interferon-? based therapy in Chinese patients with chronic hepatitis B.
23207147 2013 Interferon-?s: special immunomodulatory agents and potential therapeutic targets.
22962576 2012 Identification of pro-inflammatory cytokines associated with muscle invasive bladder cancer; the roles of IL-5, IL-20, and IL-28A.
22891284 2012 Type III IFNs are produced by and stimulate human plasmacytoid dendritic cells.
22825757 2012 Role of the p38 MAPK signaling pathway in mediating interleukin-28A-induced migration of UMUC-3 cells.
22560878 2012 Interleukin-28A triggers wound healing migration of bladder cancer cells via NF-?B-mediated MMP-9 expression inducing the MAPK pathway.
22253847 2012 Sequence analysis of the IL28A/IL28B inverted gene duplication that contains polymorphisms associated with treatment response in hepatitis C patients.
21499846 2011 IL-29/IL-28A suppress HSV-1 infection of human NT2-N neurons.
21170333 2010 Comparative analysis of the lambda-interferons IL-28A and IL-29 regarding their transcriptome and their antiviral properties against hepatitis C virus.
21145813 2011 Interferon-lambda serum levels in hepatitis C.
20712453 2010 Interferon-lambda: a new addition to an old family.
20576307 2010 Common variation of IL28 affects gamma-GTP levels and inflammation of the liver in chronically infected hepatitis C virus patients.
20235331 2010 Interferon-lambda genotype and low serum low-density lipoprotein cholesterol levels in patients with chronic hepatitis C infection.
19798076 2009 Despite IFN-lambda receptor expression, blood immune cells, but not keratinocytes or melanocytes, have an impaired response to type III interferons: implications for therapeutic applications of these cytokines.
19304895 2009 Interferon-lambdas: the modulators of antivirus, antitumor, and immune responses.
19193806 2009 Lambda interferon inhibits human immunodeficiency virus type 1 infection of macrophages.
17367910 IL-28 and IL-29: newcomers to the interferon family.
16618774 2006 Characterization of the mouse IFN-lambda ligand-receptor system: IFN-lambdas exhibit antitumor activity against B16 melanoma.
16539846 2006 Liposome-mediated IL-28 and IL-29 expression in A549 cells and anti-viral effect of IL-28 and IL-29 on WISH cells.
16478884 2006 Interferon-lambda-treated dendritic cells specifically induce proliferation of FOXP3-expressing suppressor T cells.
16413080 2006 Purification and characterization of recombinant human interleukin-29 expressed in Escherichia coli.
16146571 2005 Novel type I interferon IL-28A suppresses hepatitis C viral RNA replication.
16051921 2005 IL-28A and IL-29 mediate antiproliferative and antiviral signals in intestinal epithelial cells and murine CMV infection increases colonic IL-28A expression.
15899585 2005 Biological activity of interleukins-28 and -29: comparison with type I interferons.
15850793 2005 SOCS-1 inhibits expression of the antiviral proteins 2',5'-OAS and MxA induced by the novel interferon-lambdas IL-28A and IL-29.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12483210 2003 IFN-lambdas mediate antiviral protection through a distinct class II cytokine receptor complex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12469119 2003 IL-28, IL-29 and their class II cytokine receptor IL-28R.