Property Summary

NCBI Gene PubMed Count 164
PubMed Score 172.68
PubTator Score 171.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (17)

Disease log2 FC p
Endometriosis -1.127 8.1e-03
acute quadriplegic myopathy 1.248 2.5e-06
astrocytoma 1.100 4.0e-02
chronic lymphosyte leukemia -1.200 2.4e-07
Down syndrome 1.300 1.9e-04
esophageal adenocarcinoma 1.200 2.2e-02
glioblastoma 1.600 6.1e-04
hereditary spastic paraplegia -1.109 1.5e-03
juvenile dermatomyositis 1.062 6.8e-12
lung adenocarcinoma -1.500 6.3e-17
lung cancer -2.200 4.5e-05
lung carcinoma -1.500 8.9e-20
Multiple myeloma 1.354 3.9e-02
osteosarcoma 1.992 3.5e-04
ovarian cancer -2.000 6.0e-08
pancreatic ductal adenocarcinoma liver m... -1.521 2.1e-02
primary Sjogren syndrome 1.500 2.7e-03

Protein-protein Interaction (10)

Gene RIF (152)

AA Sequence

MALLFLLPLVMQGVSRAEMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKN      1 - 70
SEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQ     71 - 140
IMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLN    141 - 210
SQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKGSLWIPVVAALLLFLVLSLVFICFYIKKINPLKEKS    211 - 280
IILPKSLISVVRSATLETKPESKYVSLITSYQPFSLEKEVVCEEPLSPATVPGMHTEDNPGKVEHTEELS    281 - 350
SITEVVTTEENIPDVVPGSHLTPIERESSSPLSSNQSEPGSIALNSYHSRNCSESDHSRNGFDTDSSCLE    351 - 420
SHSSLSDSEFPPNNKGEIKTEGQELITVIKAPTSFGYDKPHVLVDLLVDDSGKESLIGYRPTEDSKEFS     421 - 489
//

Text Mined References (167)

PMID Year Title